SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000199 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000199
Domain Number 1 Region: 305-460
Classification Level Classification E-value
Superfamily Spectrin repeat 5.21e-30
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 1000-1154
Classification Level Classification E-value
Superfamily Spectrin repeat 9.17e-29
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 411-567
Classification Level Classification E-value
Superfamily Spectrin repeat 3.24e-28
Family Spectrin repeat 0.0000243
Further Details:      
 
Domain Number 4 Region: 1212-1366
Classification Level Classification E-value
Superfamily Spectrin repeat 1.18e-26
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 5 Region: 852-944
Classification Level Classification E-value
Superfamily Spectrin repeat 6.72e-20
Family Spectrin repeat 0.00086
Further Details:      
 
Domain Number 6 Region: 4-96
Classification Level Classification E-value
Superfamily Spectrin repeat 7.92e-19
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 7 Region: 589-730
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000324
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 8 Region: 1371-1432
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000489
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 9 Region: 738-778
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000014
Family Spectrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000199   Gene: ENSGMOG00000000189   Transcript: ENSGMOT00000000204
Sequence length 1450
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4166:15749:31105:1 gene:ENSGMOG00000000189 transcript:ENSGMOT00000000204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GYKPCDPQVIQDRVAHMEFCYQELSQLAGERRCRLEESRRLWRFFWEMAEEEGWIREKEQ
ILSSSERGKDLTGALRLLRQHRALEDEMAGRWAHLQXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFESLEPEMN
SQASRVAVVNQIARQLIHNGHPGEKDIKAQQDQLNNRWSQFRDLVDQKKESLNSALGVQN
YHLDCNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEDKLAGLGKEA
ELLAEQHPEQAGAIRGRLVEISSVWDEMKETLKTREESLGEASKLQQFLRELDDFQSWLS
RTQTAIASEDMPNTLGEAEKLLAQHEGIKNEIRNYEEDYQKMRDMGEMVTQGQTDAQYMF
LRQRLQALDTGWNELHKMWENRQNLLSQSHSYQLFLRDTKQAEAFLNNQSRIQEKVASID
ERHKKNREAAVDLLMRLKDNRDLQKFLQDGQEVXXXXXXXLSLWVNEKMLTAQDLTYDEA
RNLHSKWLKHQAFMAELQANKEWLEKIEKDGKLLVSEKPETEAVVQEQLGTLQTMWAELE
STTQTKAQCLFDANKAELFTQSCTDLDKWMGGLEGQIQSDDYGKDLTSVNILLKKQQXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXLWVEERMALATSTDHGNNLQTVQMLIKKNQTLQKEIAGHQPRYDDIFQ
RSQQVVRGDGPSAQLTRQRLDQLKSLWQQMREETERRHGRLEEARHAQQYFFDAAEAEAW
MSEQELYMMSEERAKDEQSSVAMVKKHQIVEQAVEDYADTVHLLSQTSRGLVAQGHPESE
RMGMRQSQVDKLYAGLKDLSEERRGKLDERFRLFQLNREVDDLEQWVAEREVVAGSHELG
QDYEHVTMLQERFREFARDTGTIGQERVDAVNRQADELINGGHGDAATVAEWKDGLNEAW
ADLLELIDTRTQILAASFELHKFYHDAKEILGRILDKHKKLPEELGRDQNTVETLQRMHS
TFQHDIQALGTQVRQLQEDAVRLQSAYAGDKADDIQRREGEVLEAWSSLLEACDGRRLRL
LDTGDKFRFFSLVRDLLLWMEGVIRLIENQENPKDVSSVELLMNNHQGIKAEIDARNDSF
TSCIELGKALLARKHYASEEIKEKLLQLTDKRKDMIDKWEDRWEWLRLILEVHQFSRDAG
VAEAWLLGQEPYLSGREVGESVDDVEKLIKRHEAFEKSAATWEERFSALERLTTISQNGM
PSDQESPRVS
Download sequence
Identical sequences ENSGMOP00000000199 ENSGMOP00000000199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]