SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000202 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000202
Domain Number 1 Region: 34-362
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.75e-118
Family Calpain large subunit, catalytic domain (domain II) 0.0000000154
Further Details:      
 
Domain Number 2 Region: 368-523
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 6.02e-53
Family Calpain large subunit, middle domain (domain III) 0.00000186
Further Details:      
 
Domain Number 3 Region: 571-748
Classification Level Classification E-value
Superfamily EF-hand 8.38e-47
Family Penta-EF-hand proteins 0.00000885
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000202   Gene: ENSGMOG00000000192   Transcript: ENSGMOT00000000207
Sequence length 750
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1772:42894:53538:-1 gene:ENSGMOG00000000192 transcript:ENSGMOT00000000207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEGKLDYPPVGSNSIYAAILSRNETVKDAKRLKTFLELRDKYVHKKVLFEDPLFPADDSS
LYYSCKSPMKFEWKRPTEICGNPHFIIDGANRSDICQGELGDCWLLAAIACLTLNEKLLY
RVIPPDQSFTENYAGIFHFQFWRYGEWIDVIIDDRIPTFNDKLVFTKSFRKNEYWSALLE
KAYAKLHGSYEALKGGNTLEAMEDFTGGVTEYFDLLEAPKDLYSIMKKALERGSLMGCSI
DVGVRNLFSFCQVMGQGQMESRTSQGLVQGHAYSVIGLAECDEKGTDSQIRLVRLRNPWG
WVLWKGRWCADSKEWSTISTADKENLLKQTIQESEFWISFEDFKKCYSKLEMCNLTPDTL
RGDERNSWSVAVNEGRWVRGSSAGGCRNFPDTYWTNPQYRMLLYEEDDDPEDGKRACTVV
VALMQKGRRKERSKGASLYTIGFSIYEVPKEMHGCQQHLGKEFFLYTKSTAKCQSYINLR
EITERFRLPPGEYVVIPTTFKPHNEGEFILRVFSEKRSTSEEVEEEIGSDEIQPGKKQIE
KPIVFVSDRAKANKEIEHSGIPGEKKKKKRTEEETEEDKTFRAIYRQIAGEDMQICASEL
KVVMKRVLEKHNQIKTEGFSLETCRSMIALMDTDGTGKLNLQEFKHLWNKIKQWQLIFRM
YDKDKSCTISSFEMRNAVNDPHQGFHLNKQLYDILAMRYADERNNIDFDSFICCFVRLEG
MFRAFHAFDKDGDGLIKLNVLEWLQLTMYS
Download sequence
Identical sequences ENSGMOP00000000202 ENSGMOP00000000202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]