SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000216 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000216
Domain Number 1 Region: 52-304
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.21e-28
Family G proteins 0.043
Further Details:      
 
Domain Number 2 Region: 443-529
Classification Level Classification E-value
Superfamily EF-hand 1.15e-23
Family Eps15 homology domain (EH domain) 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000216   Gene: ENSGMOG00000000211   Transcript: ENSGMOT00000000221
Sequence length 535
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2692:197457:200954:1 gene:ENSGMOG00000000211 transcript:ENSGMOT00000000221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMTLRWFRNSPQALEDVRVVTEEMKNLYYKRLLPVEKHSSFSQFHSPSYEDADFDNKPMV
LVMGQYSTGKTTFIKYLIEQDFPGSRVGPEPTTDCFTAIMHGESEGIIPGNALTMDPKKP
FRNLEPFGNAFLNRFQCAQLPNQVLENISIIDTPGILTAAKRRLSRGYDFPAVLRWFAER
VDRIILLFDAHKLDFSDELTRAFLSLRGYEDKLRVVLNKADRVDSQQLMRMYGALMWSLG
KVFLTPEVLRVYVGSFWSEPRRACDHYQLLEVEEEDLLADIRNLPRNAAVRKLNDLVKRA
RLVRAHAHIIGYLKREMPSIFCKDSKKHSLIYQLPVIFTKIQQEHHVPAGDFPDCTKMQV
PSSERLLSQDFSKFKALKPSLMVSLDKLLSTDIAKLMPLLQKQEPKKKSLPGVLDGEFLG
TFRESRRSGEKDPGSGWVVERLKPKYDEIFFSLCPRDGKVSGTKAKEWMMNTKLPSSVLA
HIWRLADLDSDGALDNEEFALAMHLIEGKVEGHWLPRELPPHLVPPSKRLCESEE
Download sequence
Identical sequences ENSGMOP00000000216 ENSGMOP00000000216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]