SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000264 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000264
Domain Number 1 Region: 47-192
Classification Level Classification E-value
Superfamily EF-hand 6.16e-36
Family Calmodulin-like 0.00000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000264   Gene: ENSGMOG00000000267   Transcript: ENSGMOT00000000273
Sequence length 194
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2277:274132:279577:1 gene:ENSGMOG00000000267 transcript:ENSGMOT00000000273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKKDVKAPAAAAKKAEPAKKAEPAPEPVAVPAPKTVDLSAVKVEFTPDQMEDYREAFG
LFDRVGDNKVCYNQIADIMRALGQNPTNKEVKAILGNPSDEDMNSKRVDFEGFLPMMQTI
VNSPNKGTLDDYVEGLRVFDKEGNGTVMGAELRIVLSTLGEKMTEAEIDALMQGQEDENG
CINYESFVKHIMSI
Download sequence
Identical sequences ENSGMOP00000000264 ENSGMOP00000000264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]