SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000294 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000294
Domain Number 1 Region: 243-479
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.06e-55
Family DBL homology domain (DH-domain) 0.0000192
Further Details:      
 
Domain Number 2 Region: 480-605
Classification Level Classification E-value
Superfamily PH domain-like 5.77e-34
Family Pleckstrin-homology domain (PH domain) 0.00078
Further Details:      
 
Domain Number 3 Region: 54-109
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000107
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000294   Gene: ENSGMOG00000000254   Transcript: ENSGMOT00000000306
Sequence length 956
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1141:8533:20097:-1 gene:ENSGMOG00000000254 transcript:ENSGMOT00000000306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSHVGRIEEEEFDKYNIPPKSDSDKYKVIRTFSFLKNRMTSTRNKSKGKAKDREAKERQL
NGHQFATGSCLGPTVCLICEKPASGRDLLHCSRCMSMVHKGCKDSVPPCLKKPQDKYAVS
MVKNRTASLPQNFTLRDGPPLCVHPNTMSLPVSSPKERREGALLFNPHSGSFSNTSDSSS
PKDAWQSESSEPETDSWRIFSQSDELPQTAASSTSTDSSIGEDCLDSLVGSDLTAGAVEF
EAESWSLNVEHKFCKKQDKQEVKRQDVIYELMQTEVHHLQTLHIMAEVFRRGVREEVQLD
AEAQDRLFPVLDQLLALHHAFFCSMRERCHSSAAAAPEQDSYLIKQIGDLLLHQFTEENA
ERMKQVYGEFCSHHNDAVSFFKELQQNNKRFQTFVKQQSNNSLVRRREIPECILLVTQRI
TKYPVLLERILKYTQEATQEHADLLKALAQVREVIAAVDLRVSEYERVQRLQEVWTRTES
RSSAKLKNGHIFRKQDMMRPGQVLKHQGLLLWKTATGRLKDVMALLLADTLIFLQEKDQK
YVFAAVDQKPSVISLQKLIVREVANEERGMFLISASAAGPEMYEVHAASKDERNAWMRLI
REAVEREEEDDCTSESEDEKRAAEARIQKIHKLQESLMSRDQQIVSSLEEKLGIYAETIA
LHWKMDVSQLESRIRVQPHAEEVPQAAVWLAAALQESRSRHLYVSENLKTMLQPLAVSPC
SPDPVSDSVFPPSPPLLSPLSPLHDAGSLFEEEEEEGEGVGEGEAEWSDSATLNSLTHLQ
NGRGPEDCDSIKVDKKTTCHMRSASLFSSQSELEFNLMLIIDELIKTNISHKHVSVSPEA
DMEDSSFDSLVKTSSLHKIVCFLHESLQAFACLFSSLQVAQSVQSLTQLLYSLQVTYLLL
KKQRQELEGQLEEYQQSLERLRDGQRSVERERRRLDTQQRTLRSWRHGRQRSLPSM
Download sequence
Identical sequences ENSGMOP00000000294 ENSGMOP00000000294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]