SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000409 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000409
Domain Number 1 Region: 542-754
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.81e-42
Family DBL homology domain (DH-domain) 0.00055
Further Details:      
 
Domain Number 2 Region: 880-1029
Classification Level Classification E-value
Superfamily PH domain-like 1.67e-30
Family Pleckstrin-homology domain (PH domain) 0.0037
Further Details:      
 
Domain Number 3 Region: 740-866
Classification Level Classification E-value
Superfamily PH domain-like 5.14e-27
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 4 Region: 125-207
Classification Level Classification E-value
Superfamily Second domain of FERM 1.2e-18
Family Second domain of FERM 0.00039
Further Details:      
 
Domain Number 5 Region: 290-370
Classification Level Classification E-value
Superfamily PH domain-like 5.53e-16
Family Third domain of FERM 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000000409
Domain Number - Region: 94-125
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000951
Family First domain of FERM 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000409   Gene: ENSGMOG00000000400   Transcript: ENSGMOT00000000434
Sequence length 1044
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2924:10232:123993:1 gene:ENSGMOG00000000400 transcript:ENSGMOT00000000434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEPSDRPASAAQRLGAPDSYGVSTLEPSLRPPTTQPSGGRQVPLRVQLLDDTQEVFQIS
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVWLDLLKPILKQIRRPKNTILRFVV
KFFPPDHTQLMEELTRYLFALQIKHDLACGRLICNDTSAALMVSHIIQSEIGDFDETQSW
QHLLHNKYLPDQDALRDKITDCHRKHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNHHDTLEFSMA
SRDCCKVFWKVCVEHHAFFRLFEEPKPKPKPVLFTRGSSFRFSGRTQKQIIDYVKDSEFK
KIPFERKHSKIMSGLTSSFRSQVTTELADQTDTSSFRADHWGDPNGPPDTAVTNGFLDAP
GSDPMARSRQTRRGSWAPDQHLLNPASARGRGRPPLXXXXXXXXXXXXXXXXXXXXGPGS
PDLPTRGHRADSPDSCGCGGGAASTSPVDPLPSPLTSPLLMEAGYVRTDDEDEARRKKFP
TDKAYFLAKELLTTERTYLKDLHVVTTSFQEAVGKEEVLPENVRNLLAANYEPLLKFHQG
FLREVEQRLAQWEGRSNAHIKGDYQRVGDILLKNIQGLKQLTVQLQKHPECLVELERACR
SSCRLEAVCGDFELQKACYLPLNVFLLRPLHRLLHYKLLLERLCKHYPPTHQDFRDSRAA
LADISEMVLQLQGTMMKMENFQKLLELRKDLTGIDNLAIPGREFIRLGCLSKLSGKGLQQ
RMFFLFSDCLVYTSRGMTKANQFKVHGQLPLYGMTVRESEDEWGVPHSFTLFGQRQPVVV
AASSAAEMERWLEDIRMAVDLAEQTSDPQSDLLSSSLADKLQDEGIGEQESEEELAGSHS
SLERPGHRGNTTVHVCWHRNTSVSMVDFSVAVENQLSGNLLRKFKNSNGWQKLWVVFTSF
SLFFYKSHLDDYPLASLPLLGYSVTVPAEAENIHKDYVFKLHFKSHVYYFRSESEYAFER
WMEVIRSATYSASRTLTASRKDLY
Download sequence
Identical sequences ENSGMOP00000000409 ENSGMOP00000000409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]