SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000421 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000421
Domain Number 1 Region: 1100-1309
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.06e-27
Family Extended AAA-ATPase domain 0.04
Further Details:      
 
Domain Number 2 Region: 2099-2196,2243-2379
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.13e-23
Family RecA protein-like (ATPase-domain) 0.097
Further Details:      
 
Domain Number 3 Region: 1734-2023
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.16e-22
Family Extended AAA-ATPase domain 0.035
Further Details:      
 
Domain Number 4 Region: 1329-1547
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000177
Family Extended AAA-ATPase domain 0.082
Further Details:      
 
Domain Number 5 Region: 2020-2079
Classification Level Classification E-value
Superfamily EF-hand 0.0000259
Family Parvalbumin 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000421   Gene: ENSGMOG00000000383   Transcript: ENSGMOT00000000446
Sequence length 3807
Comment pep:novel genescaffold:gadMor1:GeneScaffold_587:346053:449995:-1 gene:ENSGMOG00000000383 transcript:ENSGMOT00000000446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYYHYIHCGIDTDHVAPMEASWLKNILGLVPTFLRSRRRPEQLSEEMREEYLFSMKKAIL
EVGPKPWSTSFIKARKKMSRQLHAINPAMLQVLQLWHVSYRDLRLVDVVAFHQRVNTLLL
SEFHSMVAFQVESAKATLFNWEVHTNYHQAYTRKLAQHITNRQSYFNCAAALMTSQLQSL
LLDSLTDYTSFISCDPHPGFIVRLMLADKTIEFQPEFSTLKAILGVYNKMLGSVSLIPRV
ETKLFSETVRVLKPVVLPMILEAHREAVLKFLRTERIAPMEYLRVYDKYTALVSMQAQEE
VSQFLREQHSFEEVMVEVIRYQQLSDQIRYTCCKEVRLGMYVVLSHDLIGTLTRRADDLQ
QELLARLLEDCRQMNKELCVDFERITEKALGSPTGTQQLMELKAFVTKVETIEMPLLEQR
LAESNARLCFLVDYVELSPADMDLNRLTVQWYRRMPSVFEDHRLILMDKTRHYQADLKLR
CQRFLEELKSYAGQVEEFSTFGDLSELSKYLKKAQILNGKLESAMIKIDGFNQEEESYDW
PLSQYPERKEIQEQLAPFLRLYETASEFRTQHQHWVHGPLSGVNPDKVEVDVGNYWRALY
KLEKGFVDTPSALNIATNVKAEVDTFKEQIPIVQVLCNPGLRDRHWDAMSEAVGFPLRPT
GEEACVARFLPMRLEQHLDRFEGISEAASKEHSLEKAMEKMEGEWGEMEFSLLPYRETGT
SILASVDEIQTLLDDHIVKTQTMRGSPFIKPFEARIKDWEGKLLLLQEILDEWLKVQSTW
LYLEPIFSSPDIMNQMPEEGRRFTAVDKTWRDTIKEVTLDKHVLAVVAIDMMLEKLKKAN
GLLELILKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVKPHLKKCFEGIASVV
FTDVLDITHMSSSEGEVVELLNTISTSKARGQVEKWLLELENNMFASLHKVIGEAIEAYP
KDLRINWVRAWPGQTVLCVSQVYWTKDIHQAIVSGPKALDEYLQVNNGQIDDIVTLVRGK
LSKQNRVTLGALVVLDVHARDVLATLIQKGVSDENDFEWLSQLRYYWVENQMQTKMINAG
LAYGYEYLGNTPRLVITPLTDRCYRTLFGALALFLGGAPEGPAGTGKTETTKDLAKAVAK
QCVVFNCSDGLDYIALGKFFKGLLSCGGWACFDEFNRIDLEVLSVVAQQILTIQRGIKAK
AEMLMFEGTELRLDPSCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLY
SCGFVTARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLSFPEENEDIL
LLRSIIDVNLPKFLAHDLPLFAGITSDLFPGVKLPKADYGVLMDAIRENSKRMNLQVTEF
FAEKILQIFEMMIVRHGFMLVGEPFGGKTCAYRVLAAALHDIAEKGLMEENPVQIKVINP
KSITMGQLYGQFDPVSHEWADGILAVSYRAFAVSQSPDRKWLIFDGPVDAVWIENMNTVL
DDNKKLCLMSGEIIQMSPQMSLIFEPMDLEVASPATVSRCGMIYMEPHMLGWKPLLVSWL
ATLASTVSDMHQDLITGLFHRVLPACLQLVRKATKELSPTSDTNLVRSLMNLMDCMMDEF
DDEASIKSMNDRDICSWLEGIFVFCLVWSVGASCDDLGRVRFDGVVREVLVGPLSEDTRV
LHGILASVEPPAKQLTVPLPSEGTLYQYRFVKEGPGRWELWTDELKATPAICKDIQFNEI
IVPTENTVRYTALMEMLVTHQKPTIFVGPTGTGKSVYIIDFLLNKLEKDVYSPLLINFSA
QTTAAETQNIIMSKLDKRRKGVFGPPLGKKMVVFVDDVNMPARETYGAQPPVELLRQWLD
HWNWYETKECSTINLVDIQIMCAMGPPGGGRNPITARFMRHFNTVTINDFDDKTMYTIFS
RILDWHLGIRFDFPKPFAGLTPQIVQATMSVYQEATKNLLPTPAKSHYLFNLRDFSRVIQ
GICLSRPETALEPSLIKRLWVHEVQRVYYDRLVHDSDRAWLVSYLDTVTKEHLKEDFHQL
FHHLDQDRDGRVTEDDLRSLMFCDFHDPKGVDRNYREVDSLDTLRPVAEAHLDEYNTVSK
APMNLVLFRFAIQHVCRISRILQQPRGHALLVGVGGSGRQSLTRLAAHMAESELFQVEMS
KSYGITEWRDDLKLIMRKSTQGDAHGVFLFTDTQIKKXXXXXXXXXXXXXXXVPNLFAVD
EKQEICERMRLLDRQRDRDKQTDGTPLALFNMFLERCRSQLHVVLAMSPIGDTFRSRLRR
FPALINCCTIDWFQSWPEDALQAVASRFLEDMEMTDESRAGCIDMCKSFHTSTIELSERF
QTELQRHNYVTPTSYLELISTFKALLLKKRTEVMSLKRRYEVGLDKLESAAAQVASMQVE
LEALQPQLRVASKEVDELMVVMEHESAEVAETEKVVKVDEAVANEQAMAAKAIKDECDAD
LAIAMPILESALAALNTLTNQDITVVKSMKSPPPAVKLVMEAICILKGIKPDRVPDPSGS
GKKVEDFWGPAKKLLGDMKFLQSLHEYDKDSIPAAYIAIIRNKYITNPDFVPEKIRTAST
AAEGLCKWVLAMESYDNVAKVVAPKKEKLGQAEGELSVAMESLGKKQAALKEVQEKLAKL
KQTLEANKNKKADLENQVDLCSKKLERAEQLIGGLGGEKSRWSETALNLGEIYDNLTGDV
LISSAIVAYLGAFTSSYRQCQTEEWMALCKSRQIPCSPAMSLMKSLGEPVKIRAWTIAGL
PSDNFSIDNGIIISNARRWPLMIDPQGQANKWVKNMEKSNRLNVIKLSDADFVRSLENCI
QFGTPVLLENIGEELDPILEPLLLKQTFKQGGAICIRLGDSTIEYSPDFRFYITTKLRNP
HYLPETSVKVTLLNFMITPEGMQDQLLGIAVARERPDLEEEKQALILQGAENKRQLKEIE
DKILEVLSSSEGNILEDETAVQVLSSSKVLANEISEKQAVAEVTEVKIDETRMGYTSIAV
HSSILFFSIAELANIEPMYQYSLSWFINLFVSSVDNSEKSDVLEKRLQILRDHFTYSLYV
NVCRSLFEKDKLLFSFCLNVNLLMHDKMVDTQTWRFLLTGGVGLENPHSNPCTWLPKKAW
DEMCRLQDMERFQGLRRDMARLRDQWKEVYDSPTPHHAPFPGEWQERLGPFQKMLVIRCL
RPDKIVPIVQEFVADSLGRPFIEAPPFNLGAAFLDSHCCAPLIFILSPGSDPMAALLKFG
DEKGFSGSKLTSLSLGQGQGPIAMSMIEKGVKEGTWVVLQNCHLATSWMATMERVCEELS
PDTTHPDFRLWLTSYPSPTFPVAVLQNGVKMTNEAPKGLRANIARSFLMDPISDPLFFNS
CSKPVVFKKLLYSLCFFHALAQERRKFGPMGWNIPYEFNETDLRISVQQLHMFLEQYEDV
PFDAIRYMTGECNYGGRVTDDWDRRTLRTILSIFYTPELIEDPSYAFDPSGLYYAPAEGD
XXXXXXXXXXXXXNPSPEIFGMNANADITKDQSETQLLFDSILLTQSRSSGGDASSSDDM
VFEVAADVLGKLPADFDLEAAMRRYPTDYNQSMNTVLVQEMGRFNNLLRTVRDSCANIQK
AIKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVQDWYDEGTPAVFWMSG
FFFTQAFLTGGQQNYARKHTIPIDLLGFDFQVLDDREYTRPPEDGVYIRGLFLDGARWER
KTKLLAESFPKVLHDVMPVMWLKPVKRQDIPERMCYLAPVYKTGERRGTLSTTGHSTNYV
IAMTLNSDVPSEHWVRRGVALLCQLSV
Download sequence
Identical sequences ENSGMOP00000000421 ENSGMOP00000000421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]