SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000424 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000424
Domain Number 1 Region: 55-207,251-461
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.27e-48
Family Glycerol-3-phosphate transporter 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000000424
Domain Number - Region: 27-68
Classification Level Classification E-value
Superfamily Sema domain 0.0392
Family Sema domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000424   Gene: ENSGMOG00000000427   Transcript: ENSGMOT00000000449
Sequence length 472
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3888:4257:19636:-1 gene:ENSGMOG00000000427 transcript:ENSGMOT00000000449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YVLLHASRKTFSNVKVSISAQWTPSVQNESLPAFSPSQVWEEHRLFADEEEATLFLGALD
TIFLFSYAIGLYVSGVIGDRMNLRYVLCFGLCGSATVEFVFGTLTEWLHLYNVYLYCGLW
VLNGLLQSAVWPCVVAIMGNWFGKSGRGFVFGLWSACASAGNILGAFLASSVLKYGYEYA
FLVTSVVQFAGGVVVFFGLLTSPKEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYSLAYACLKLVNYSFFFWLPFYLSSNYG
WKEAQADRLSIWYDVGGIVGGTVQGLVSDFLGKRAPVLAVSLLLAMGALVGYSHSPADQV
VNAALLALTGFFIGGPSNMISSAISADLGRQDALRGSQEALATVTGIVDGTGSIGAAGGQ
YLVSMIESRLGWMYVFYFFIVMTGGSILFIAPLIYRETRSMWRDRQGLHQQL
Download sequence
Identical sequences ENSGMOP00000000424 ENSGMOP00000000424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]