SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000461 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000461
Domain Number 1 Region: 13-192
Classification Level Classification E-value
Superfamily EF-hand 2.4e-46
Family Calmodulin-like 0.000000257
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000461   Gene: ENSGMOG00000000472   Transcript: ENSGMOT00000000487
Sequence length 196
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4297:10832:15139:1 gene:ENSGMOG00000000472 transcript:ENSGMOT00000000487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGEDELEMTMVSHRPEGLQQLEAQTNFSRQELQILYRGFKNECPSGVVNEDTFKHIYAQF
FPHGADASTYAHYLFNAFDTTNNGSIKFEDFVMGLSTLLRGTLRDKLEWTFHLYDINRDG
YINREEMTEIVRAIYDMMGKYTYPALKGDVPQQHVDAFFQKMDKNKDGVVTLEEFIVACQ
EDEMMMSSMQLFENVM
Download sequence
Identical sequences ENSGMOP00000000461 ENSGMOP00000000461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]