SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000516 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000516
Domain Number 1 Region: 711-1032
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.77e-83
Family p120GAP domain-like 0.0000000000811
Further Details:      
 
Domain Number 2 Region: 152-252
Classification Level Classification E-value
Superfamily SH2 domain 2.23e-26
Family SH2 domain 0.00056
Further Details:      
 
Domain Number 3 Region: 335-443
Classification Level Classification E-value
Superfamily SH2 domain 1.13e-25
Family SH2 domain 0.00073
Further Details:      
 
Domain Number 4 Region: 462-567
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-22
Family Pleckstrin-homology domain (PH domain) 0.0071
Further Details:      
 
Domain Number 5 Region: 589-722
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000982
Family Synaptotagmin-like (S variant) 0.018
Further Details:      
 
Domain Number 6 Region: 263-336
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000315
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000516   Gene: ENSGMOG00000000513   Transcript: ENSGMOT00000000544
Sequence length 1042
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1980:83286:108138:1 gene:ENSGMOG00000000513 transcript:ENSGMOT00000000544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAAEVGSEETGSVSTGTGVAGSGGPDTAHFPYYSKSTRVRVTDLGPVVEPAMRQNSNTS
PDSPPDMSIIYPVSRGEMSATGSGGHSIILGTSSGTVGGMCSPTSDDPSCRMSPTSSCPD
GPNLFPPLPPPPPPPPGCGVLGTVDESDMQDGPEYEEEEVVFPLSAPPTNQWYHGKLDRT
IAEERLRQAKTPGSYLIRESDRRPGSFVLSFLSMTGVVNHFRIIAMCGDYYIGGRRFSSL
SDLIGYYSYVSCLLKEEKLLSPVAPPEPVEDRRRVRAILPYTKVPDTDEISFLKGDMFIV
HNELDDGWLWVTNVRTEEQGLIVEDLVEEVGREEDPHEGKVWYHGKISKQEAYNLLMTVG
QVCSFLVRPSDNTPGDYSLFFRTNENIQRFKISPTPNNQYMMGGRYYYSVDDIVDHYKKE
QIVEGYNLNEAVSVQHQEQVLSDIVDGKEIYNTIKRKTKDAFYKNIVKKGYLLFNKGKGK
RWKNLYFILEGNDAQLIYFESEKRATKPKGLIDLSVCSVYGVHDSLFGRPNCFQVVVQHF
SEEQYIFYFAGEAPEHAQDWMKCLQTFCSNLRKPTQQTINKRLRQVSSLVLYVEEAHKLP
VKHFNQPYCNIYLNSVQVAKTHPREGQNPVFTEEFIFDDLSCEINRFEISLSNKTKKSKE
SDILFMRCQLNRLQKGQMIDEWFPLSSHVPLKGIEPGSLRVRARYSMEKIMPEEEYSEFK
EMILHKEFHVIYDLAHVCGQDRTLLASLLLRIFRHEKTEAPLLRTLNDREINMEALDEAT
TLFRATTLASTLMEQYMKATATPFVHHALKEAILKIMESKQSCELNPSKLDKNDDVNLNL
AHLLNILSELVEKIFMAAEILPPTLRYIYGCLQQSVQQKWPANTTMRTRVVSGFVFLRLI
CPAILNPRMFNIIADPPSSIAGRTLTLVAKSVQNLANLVEFGAKEPYMEGVNPFIKNNKH
RMIMFLDELGNVPDLPETTEHFRTDLSRDLAALHELCAAHSDGLRIRSTQRAAQQHVLKK
LLAITELLQQRQDHYAMSNSNR
Download sequence
Identical sequences ENSGMOP00000000516 ENSGMOP00000000516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]