SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000000540 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000000540
Domain Number 1 Region: 126-370
Classification Level Classification E-value
Superfamily vWA-like 4.34e-81
Family Integrin A (or I) domain 0.0000000866
Further Details:      
 
Domain Number 2 Region: 369-454
Classification Level Classification E-value
Superfamily Integrin domains 2.72e-20
Family Integrin domains 0.00034
Further Details:      
 
Domain Number 3 Region: 19-72
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000392
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 4 Region: 578-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Integrin beta EGF-like domains 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000000540
Domain Number - Region: 552-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000698
Family Integrin beta EGF-like domains 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000000540   Gene: ENSGMOG00000000551   Transcript: ENSGMOT00000000568
Sequence length 782
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2861:140418:158116:1 gene:ENSGMOG00000000551 transcript:ENSGMOT00000000568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLILLSLLLRYCFSNVEGSCSSGSASTCDECLSQSPRCAWCTQENFTNWLSVWERCDTP
ETLLEKGCLQERLEFHVSHAEVLVDGPLGRRSGPSTNSTQVSPQRMALKLRPGIPMTFQV
RVQQTEDYPVDIYYLMDLSASMTDDLEMIKDLGSTLTREMSNLTSKFSLGFGSFVEKPVL
PFIKITEEELANPCRSVEVVCQPTFGYKHVLSLTTDTSMFNQIISKQHISANIDVPEGGF
DAIMQAAVCGDKIGWRNDSMRLLVFASDADSHFGMDSKLAGIVIPNDGQCHLDENNDYSM
SAILEYPTLGQLIDKLVENNILLIFAVTENQKHNYENYANLIPGATVGVLASDSRNILEL
IITAYKDLRSEIELEVLGDTEELQMAFTSICPDGSIYPGLKRCSSIKAGDTVVFNVSVEL
TSCLPAPGRFLLRPVGYQDGLVVDLSSLCSCHCPPRPPGTTAGLCHEGQGSPECGVCVCQ
PGFVGSQCECSEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXHGQCDCGQCVCDSGWLGEYCNCSSSTEACVSQDGTSCSGRGHCDCGQC
VCSVPGASGKLCEKCPTCGDTCTSARACVECHLQTKDSLDMCVQRCTVPKISINTSTXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCPEPPNVIMIILGVSLSVLLVGL
VLLVAWRLLVSVHDRKEVARFEAERSNAKWQSGTNPLFRSSTSTFKNVTYKNTGRDKSIT
LG
Download sequence
Identical sequences ENSGMOP00000000540 ENSGMOP00000000540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]