SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001002 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001002
Domain Number 1 Region: 568-1041
Classification Level Classification E-value
Superfamily Ras GEF 9.55e-134
Family Ras GEF 0.000000000000659
Further Details:      
 
Domain Number 2 Region: 7-177
Classification Level Classification E-value
Superfamily Histone-fold 6.28e-54
Family TBP-associated factors, TAFs 0.000000338
Further Details:      
 
Domain Number 3 Region: 209-397
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.33e-43
Family DBL homology domain (DH-domain) 0.000000154
Further Details:      
 
Domain Number 4 Region: 506-574
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000558
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001002   Gene: ENSGMOG00000000951   Transcript: ENSGMOT00000001038
Sequence length 1340
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3467:68075:110792:-1 gene:ENSGMOG00000000951 transcript:ENSGMOT00000001038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMQPQHIYDFSSDENSHKWRGLFVQALRKVQMQVHPTLDAKEDALQHIEELILQLLNMLC
VAQPRSVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPLLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVGNIRHYEISQQDIKVSMCADKVLMDMFDQEE
DIGLVSQCTEEPSSSGEVTYDDLVRLEIAEERQYLRELDLIIKVFRNHFLSNNKIFTPQD
VEVIFSNILDIHELTVKLLGLIEDAVEMTADGSPHPLVGSCFEDLAEEQAFDPYETLSQD
ILNKNFHEHFNSLMSRPTVGLYFQSIAEGFKEAVQYVLPQLMMVPVYHCMHYFELLQQLQ
EHSEDQDDRECLKQAITALLNLQCSVERIYTKHQPRRKPGXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXIADRDGDAASELRHAFELVGKDENIAVFCARTAEEKAAWMA
ALVTLQYRSTLDRMLDSVLQHEEQAQPLRLPAPEVYRFAVQDSEENIVFEDRVQSKTGIP
IIKGGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIDRIDIPEPEPTEAD
RQALWNGDQPMAAELQRFRKEYVQPVQLRVLNVFRQWVEHHFYDFENDLELRSRLEEYIT
SKIQLRGKSMRKWVESINKIIKRKLQTQANGVSHSITFESPPPPIEWHISRAGQLDTFDL
MTLHPIEIARQLTLLESELYRAVRPSELVGSVWTKEDKEKNSPNLLRMIRHTTNLTLWFE
KCIVEAENLDERVAVFTRVIEVLQVFQELNNFNGVLEVVSAINSVPVYRLDHTFEAVPER
KKKILEEAVELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNPDHLKRHGKELI
NFSKRRKVAEITGEIQQYQNQPYCLKQEHDVRRFFENLNPMGNMSEKDFYDYLFNKSQEI
EPRNCRQPPRFPRKTLYTLKSPGIRPVRTSTSGTLKGHPVALEREPPHKITFRSIAETEL
ETPASASVPTSPNTPTPPQSASSDLSSVFTEPDLGSSYGGGNSIFAPVILPPSXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXQPAFQALSLVENTDSSQ
Download sequence
Identical sequences ENSGMOP00000001002 ENSGMOP00000001002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]