SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001065 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001065
Domain Number 1 Region: 5-205
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.14e-33
Family G proteins 0.0013
Further Details:      
 
Domain Number 2 Region: 413-559
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.19e-20
Family G proteins 0.013
Further Details:      
 
Domain Number 3 Region: 173-253,310-362
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000981
Family Calmodulin-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001065   Gene: ENSGMOG00000001021   Transcript: ENSGMOT00000001103
Sequence length 575
Comment pep:novel genescaffold:gadMor1:GeneScaffold_859:10711:25798:-1 gene:ENSGMOG00000001021 transcript:ENSGMOT00000001103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRSMKRDVRILLLGEPGVGKTSLIMSLVGEEFPDEVPLRAEEITIPADVTPEKVPTHIVD
YSETEQTEEVLQAEIIKANVVCVVYDVTKEETIQKIKTKWIPLVNGNAEKGNKVPIILVG
NKSDLRSGSSMETILPIMNQFSEIETCVECSAKNLKNISELFYYAQKAVLHPTAPLYDPE
DKQLKPQCVRALSRIFYISDRDNDRILSDVELNRFQKACFGNPLAPQALEDVKTVVWKNT
SDGVQDNGLTLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRVPAGC
TTEINHLGHQFLQRLFDKYDEDKDSALSPGELRNLFCVFPYTPWGPEVFSSVPTTDQGYL
SNWGLSAYLDIHRCLEYLGYLGYPILAEQDSQTTAVTVTQQKELDLAQSQTQRTVFLCKV
IGPRGTGKTAFLQAFVGRNIVLRDGSHALSPYTINKVTVNNQERFLILYEVDVETEFLKA
SHASCDVACLMYDASDPQSFDYCASIYKQHYMSSQVPCVLVSSKADLAEVKQLHGTTPAQ
FCYKHRLPPPMAFSVLSPDASADAIYTKLAWAAMF
Download sequence
Identical sequences ENSGMOP00000001065 ENSGMOP00000001065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]