SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001166 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001166
Domain Number 1 Region: 211-415
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 8.11e-66
Family Fibrinogen C-terminal domain-like 0.0000236
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000001166
Domain Number - Region: 139-186
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0489
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001166   Gene: ENSGMOG00000001102   Transcript: ENSGMOT00000001206
Sequence length 424
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3548:26253:30041:1 gene:ENSGMOG00000001102 transcript:ENSGMOT00000001206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPLFLFLVALLLNAVLAAPGEEGGAGLGRGPYASWDDVNVLAHGLLQLGQGLKEHVEKNK
AQVREVNVRLRSLNGSLVELGRGGPGRGGALAREGVVAELRAQTEELRSERLGEDRLERV
EEKVSRGLRETWSEGNSSDDGDAAAIQRTLAAQNRRIDDLLDKIRQQQDKLEKQGLHLQA
LQTKVGQRRAKVHRRSHEDTAPRGAPQNSQQTGLPKDCHEVFTSGQRASGVYTIQPAFSP
FSVLCEMNSDGGWTVIQKRQDGSQSFNQLWESYQKGFGHLNGEFWLGLDRIHSLSNQGRH
TLQVQLSHRTGAEQLVNYRFRLDGPENDYALHLAPTNPAGVQAGAMATGASGLPFSTADR
DNDLSADINCAKSLSGGWWFSSCGEWNLNGRYPKRHLNRQRSPRQQMSWATAQAALTSVV
MKIA
Download sequence
Identical sequences ENSGMOP00000001166 ENSGMOP00000001166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]