SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001176 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001176
Domain Number 1 Region: 191-290
Classification Level Classification E-value
Superfamily Histone-fold 3.84e-25
Family Nucleosome core histones 0.0055
Further Details:      
 
Domain Number 2 Region: 815-922
Classification Level Classification E-value
Superfamily POZ domain 2.55e-22
Family BTB/POZ domain 0.0045
Further Details:      
 
Domain Number 3 Region: 496-645
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.95e-19
Family Ankyrin repeat 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000001176
Domain Number - Region: 121-182
Classification Level Classification E-value
Superfamily Histone-fold 0.000167
Family Nucleosome core histones 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001176   Gene: ENSGMOG00000001108   Transcript: ENSGMOT00000001217
Sequence length 981
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3870:37600:175776:1 gene:ENSGMOG00000001108 transcript:ENSGMOT00000001217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGKGKTVVRTLEDLTLDSGYGGAADSVRSSSVSLCCSDTHQSYSHGGNCWHLTESMHSR
QNSLDTVNTVLAEDTDVSEWSGLCAKLPELEDVPWSLGEVEGALRKHEDPAMGVPSREVL
AKLSVLISRALVRVAREAQRLSLRYAKCTKHEVQSAVRAVLSWTISVNCVAAALSALSLY
NMSTAADKFSRGKSTRCGLAFSVGKFFRWMVESRVALRVHEHAAIYLAACTEILFREVFA
RVQRSSLLERDNGVPKLTLESLEHAINNDSEMWGLLQPCQHLICGKNSSXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMHHLQPLHLQTPT
NGTPVRLKPAGPPGAPAVQWEPEALYTLCYFMHCPQIEWENPNLEPAKVTLHKDRPFLVL
PPLMEWIRVAVAHTAHRRSFSVDSDDVRQAARLLLPGVDCEPRQLKADDCFCASRKLDAA
STEAKFLQDLGFRMLNCGRTDLVKQAVNLLGPDGINSMSEQGMTPLMYACVRGDEAMVQM
LLDAGADINSEVSVXXXQLLLDNKANVEGALQEGVENYTETPLQLAAAAGNFELVSVLLE
RGADPMIGTVSRNGIVSPAAPQGDMNSFSLAAAHGHRNVFRRLLSQTEKEKGDVLSLEEI
LAEGSEPGGGDKRAALLPNGGGATLLRTGKAKLRALREAMYHSAEHGHVDITIDIRSLGV
PWTLHTWLESLRTCFIQQRRPLIQGLLKDFSAIQEDEYTEELITHGLPLMFQILRASKNE
VISQQLAVIFTQCYGPFPIPKLTEIKKKQTSRLDPHFLNNKEMSDVTFLVEGKPFYAHKV
LLFTASARFKSLLQNRPAAENTCIEISHVKYNIFHLVMKFLYYGGTETLHIRNTEIMELL
SAAKFFQLEALQRHCEIICSKNITTETCVDLYKHAKFLGAADLTAFIEGFFLKNMVLLTD
LEPFKQLLYELSPPAQQLAAA
Download sequence
Identical sequences ENSGMOP00000001176 ENSGMOP00000001176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]