SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001282 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001282
Domain Number 1 Region: 1-92
Classification Level Classification E-value
Superfamily EF-hand 1.89e-24
Family S100 proteins 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001282   Gene: ENSGMOG00000001243   Transcript: ENSGMOT00000001328
Sequence length 97
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3799:97175:99529:1 gene:ENSGMOG00000001243 transcript:ENSGMOT00000001328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSQLEGAMDAMIKVFYNYSGNDGDKYKLNKGELKELLTSELTDFLTSQKDPLLVEKIMN
DLDSNKDNEVDFNEFVVLVAALTVACNDFFQEQQKLK
Download sequence
Identical sequences ENSGMOP00000001282 ENSGMOP00000001282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]