SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001499 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001499
Domain Number 1 Region: 8-155
Classification Level Classification E-value
Superfamily EF-hand 6.4e-43
Family Calmodulin-like 0.000000311
Further Details:      
 
Domain Number 2 Region: 299-629
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.3e-38
Family WD40-repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001499   Gene: ENSGMOG00000001404   Transcript: ENSGMOT00000001553
Sequence length 634
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2369:325:23905:-1 gene:ENSGMOG00000001404 transcript:ENSGMOT00000001553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDI
FDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVG
NNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAHDAGLGHVLDGELGFPAGPGDPPHGS
GEVVTFQGLHEDQRERSQSTQRPDVKPRICPLRLTVCYIKSLQEEFILTSTWKPSTKALT
KSDAFFSLSPDNGGKGRLTALAVHPGSCLRLELRLLFTAVNSSGPPGPTATPTGRPQIIS
HIQKSLNYTIFDCKWIPCSAKLVCLGNLARGTGVLQIYEVQGGEIEKAKPFKCGTFGATS
LQQRHLATGDFDGNLHIWDLEAATEPLYSVKAHKEIVNSLDGVGGLGVGDGAPEIVTGSR
DGTVKVWDPRQKDTPVANMEPGAGEAKRDCWTVAFGHAFNQQDRCVCAGYDNGDIKLFDL
RNMAVRWETNIKNGVCCVEFDRKDINMNKLVATSLEGTFHVFDMRTQHPTKGFASVSEKG
HKSTIWQVRHLPQNRDVFMTAGGAGNLHLWKYDYPAQRSGEDSAGVGVAGTVNLLQNVTL
STQPIASLDWSPDKQGLCVCSAFDQSVRVLIVTK
Download sequence
Identical sequences ENSGMOP00000001499 ENSGMOP00000001499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]