SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001510 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001510
Domain Number 1 Region: 8-159
Classification Level Classification E-value
Superfamily EF-hand 1.36e-45
Family Calmodulin-like 0.000000801
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001510   Gene: ENSGMOG00000001449   Transcript: ENSGMOT00000001564
Sequence length 161
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2589:4291:23365:-1 gene:ENSGMOG00000001449 transcript:ENSGMOT00000001564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDVYKAAVENLTEEQKNEFKAAFDVFIQDAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDASGTVDFDEFLVMMVRCMKEESKGKSEEELAELFRMFDKNGDGYIDLDELKAM
LESTGECITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Download sequence
Identical sequences ENSGMOP00000001510 ENSGMOP00000001510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]