SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001533 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001533
Domain Number 1 Region: 183-305
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-26
Family Third domain of FERM 0.0046
Further Details:      
 
Domain Number 2 Region: 84-182
Classification Level Classification E-value
Superfamily Second domain of FERM 3.93e-21
Family Second domain of FERM 0.0022
Further Details:      
 
Domain Number 3 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.47e-19
Family First domain of FERM 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001533   Gene: ENSGMOG00000001473   Transcript: ENSGMOT00000001588
Sequence length 447
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4651:10100:29516:-1 gene:ENSGMOG00000001473 transcript:ENSGMOT00000001588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCHITRPDSVVLEVEVDAKANGEDCLNKVCRKLGIIEVDYFGLQFSGSKGENLWLNLRN
RIGQQVDNVAPCRLRLRVKFFVEPHLILQEQTRHMFFMHVKEDLHSGHLRMASEQAEELG
ALLAQAEFGDYNQNTAQYWYRELCGEEPCPDTVNRIVSRHQALEGAGPGSVEYQALQLVS
SLEHYGVEWHWARDADGQRLAIGVGPEGIAVCKEDFALVNRICYPVIQIATQSGKSVYLT
VTKETNDSVVLLFKLISHRAASALYRAITETHAFYRCDTVTNAVMMQYSRDFKGHLASLF
LHENVNMGKKYVFDIRRTSKEVYDHARRALYNAGITDLVSGGGGGXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTC
PVCRSDVEHVQHVYLPTCTSLLSLTLT
Download sequence
Identical sequences ENSGMOP00000001533 ENSGMOP00000001533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]