SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001620 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001620
Domain Number 1 Region: 2-199
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.93e-47
Family DBL homology domain (DH-domain) 0.00038
Further Details:      
 
Domain Number 2 Region: 217-321
Classification Level Classification E-value
Superfamily PH domain-like 0.000000164
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 3 Region: 334-364
Classification Level Classification E-value
Superfamily SH3-domain 0.0000282
Family SH3-domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001620   Gene: ENSGMOG00000001547   Transcript: ENSGMOT00000001678
Sequence length 384
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4014:7698:18038:-1 gene:ENSGMOG00000001547 transcript:ENSGMOT00000001678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMFEVLTSEASYLRSLRVLTNHFHESRDLEEAMIIRDRKTLFSNVLRVREVSERFLKDLE
DRMEQNLVFTDICDIIHYHAQHNFPVYIDYVRNQIYQEKTYTTLMKSSAQFAEVISRLQE
SPLCQRLPFMSFLLLPFQRITRIKMLIENILKRTKEQTKEEQTASKALDSVSKIIEECNT
EVGKMKQVEELIVLSKMLEFDKLKXXXXXXXXXXXXKKGELGEMSKGATLFNMRAKFSPV
HLFLFNDLLILASKKGPERFVVLDYAHRSLVQVEGGGGAHRAGPLENCFTLTLLENHQGR
LMERLLKAPSQSDLHRWVVAFPPPLPLSPSLLSPSGWYEGSRLSDGQKGWFPVSSVVEIT
NEHVRRRNLRERYRVMQAASQVAN
Download sequence
Identical sequences ENSGMOP00000001620 ENSGMOP00000001620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]