SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001718 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001718
Domain Number 1 Region: 1-299
Classification Level Classification E-value
Superfamily Sema domain 1.19e-112
Family Sema domain 0.00000000759
Further Details:      
 
Domain Number 2 Region: 295-346
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000061
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 3 Region: 365-446
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000149
Family I set domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001718   Gene: ENSGMOG00000001255   Transcript: ENSGMOT00000001777
Sequence length 466
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1199:20921:26119:-1 gene:ENSGMOG00000001255 transcript:ENSGMOT00000001777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPVFVKIQKIPDSTQANDDKLYFFFREKSLDSTGGNNPIMVSRVGRVCLNDDGGQRSLVN
KWTTFLKARLVCSVTGGDGVETHFDELRDVFILPTQDARNPVVYGVFATAGSVFKGSAVC
VYAMSDIRNVFNGPFSHKHGHNYQWTPYTGKIPYPRPGTCPGGTFTPGLRSTKEFSDEAV
NFVRAHPLMYQPVYPLHKRPLVLSTAGDHRFTSIAVDIVDATDGKYEVLFLGTDRGTVQK
VIVLPKDASSTEQLILEEVEVFRTPTTIKTMRLSSKRQQLYVTSDRGLTQVSLHRCGVYG
RACSDCCLARDPYCAWDGETCASFTPSAKRRSRRQDVKHGDPLSQCRGFNTKETIDGKMT
GAVQFGVEGSNVFLECQPRSPQASVKWLLQKDGRRKLLNREHEVLKTGHGVLLKELVQAD
AGVYHCQATENNYRHTVARIALRILDREIVEALTATDVSPLHRQPH
Download sequence
Identical sequences ENSGMOP00000001718 ENSGMOP00000001718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]