SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001750 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001750
Domain Number 1 Region: 86-288
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-50
Family DBL homology domain (DH-domain) 0.0000022
Further Details:      
 
Domain Number 2 Region: 275-432
Classification Level Classification E-value
Superfamily PH domain-like 2.87e-33
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 
Domain Number 3 Region: 545-646,694-720
Classification Level Classification E-value
Superfamily SH2 domain 5.19e-26
Family SH2 domain 0.00077
Further Details:      
 
Domain Number 4 Region: 461-528
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000276
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 5 Region: 651-708
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000235
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001750   Gene: ENSGMOG00000001637   Transcript: ENSGMOT00000001811
Sequence length 726
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3686:183929:250550:-1 gene:ENSGMOG00000001637 transcript:ENSGMOT00000001811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFQVISSLSRISRHSIAQIKGIXXXXXXXTALNEDDVYRSLEELADEHDLGEDDIYDCVP
CEDDGDDIYEDIIKVEVRQPMKMGMSEDDKRNCCLVEIQETEAKYYKTLEDIEKNYMIPL
KQVFTVHEMEAIFVNLEDVIKVHFTLLRAIDLNMVGGGNGLGNIFLDFKERLLIYGQYCS
HMETAQKTLDDLIATREEVKVKVEECTMKVQEGKFKLQDLLVVPMQRVLKYHLLLKELLS
HSAERPERQQLKEALEAMQDLAMYINEVKRDNETLKKISEFQSSIENLQVKLEEYGRPKI
DGELKVSSIINRTKQDRYIFLFDKVVIVCKRKGYSYELKEIIELQSYKMSDDLMNNRDMK
KWSYGFYLIHLQGKQGFQFFCKTEETKRKWMEQFEMAMSNIKPERATANHHNFQMHTFDK
NTNCRACKMLLRHSRGIFYQGYFCAHCGTGAHKECLEVITICKITGPKMVAVRNYHGTPA
PPGKPPLALQTGDFIELLKGEPETSWWEGKILQTHKSGFFPSTCVKPCLDPKSCPSRQSS
RETDYYGYPWFAGNMERQQADNLLKSHISGTYLIRERTAEAERFAISIKFNDEVKHIKVI
EKDSWIHITEAKKFESLLELVEYYQAHSLKESFKLLDTTLRYPYKSKERSLTRTSTRSPV
FTPRVVNTAVARYNFAARDMRELSLREGDIVKIYSKIGGDQGWWKGEANGRIGWFPSTYV
DEEAVQ
Download sequence
Identical sequences ENSGMOP00000001750 ENSGMOP00000001750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]