SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001784 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001784
Domain Number 1 Region: 175-335
Classification Level Classification E-value
Superfamily Sema domain 1.7e-32
Family Sema domain 0.013
Further Details:      
 
Domain Number 2 Region: 705-804
Classification Level Classification E-value
Superfamily E set domains 0.000000000000014
Family Other IPT/TIG domains 0.009
Further Details:      
 
Domain Number 3 Region: 4-105
Classification Level Classification E-value
Superfamily Sema domain 0.000000000000068
Family Sema domain 0.0038
Further Details:      
 
Domain Number 4 Region: 906-991
Classification Level Classification E-value
Superfamily E set domains 0.000000000602
Family E-set domains of sugar-utilizing enzymes 0.059
Further Details:      
 
Domain Number 5 Region: 802-848
Classification Level Classification E-value
Superfamily E set domains 0.0000000917
Family Other IPT/TIG domains 0.05
Further Details:      
 
Domain Number 6 Region: 1302-1324,1549-1611
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000188
Family p120GAP domain-like 0.053
Further Details:      
 
Domain Number 7 Region: 645-677
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000275
Family Plexin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001784   Gene: ENSGMOG00000001653   Transcript: ENSGMOT00000001845
Sequence length 1611
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1077:3:317071:1 gene:ENSGMOG00000001653 transcript:ENSGMOT00000001845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEPATMSGVVVPPSPFGGGGGGKFFVGTPIEGKSEYFPTLSSRRLTGNEEDADMFSFVYQ
DEFVSSQLKIPSDTLSKFPAFDIYYVHGFHSEQFVYYVTLQLDTQLTSPDASSEXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNRARP
PRETALCLFTLRRVKERIKERIQSCYRGEGKLSLPWLLNKELACINSPLQIDDNFCGQDF
NQPLGGTSTIEGIPLFVDKEDGMTSVAAYDYHGNTVAFAGTRNGHLKKVGXXXXXXXXXX
XXXYEEVVVSEGKAILRDLLFSPDHQHLYALTEKQXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXCSRKDMCERADEPARFTEHVEQCVRLSVQPESVSVTMSQVPLVLQALNVPS
LSAGVNCSFEDFLETEARIYGGRIFCLSPSNKEVAPITQDQGDQRVIKLYIKSRETGKKF
ASVDFVFYNCSVHHSCLSCVNGDYPCHWCKYRHMCTQDASDCSFQEGRVNTSEECPRILP
SSQMYIPVGVTRPITLLAQNLPQPQSGQRTYQCIFSIQGTSLSVPALRFNSSSIQCQKTM
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHLYKCRALRDSCGMCLKADPRFECG
WCVQDRKCSLRQECGGGGGGGASQLSPPIHDHGGWMHAAGGNGRCSHPKITKLYPETGPR
QGGTRLTILGENLGLHFRDIQTGVRLGKVPCVPLPEEYVSAEKIVCLLSDATSSRVQEAH
VEVCVRDCVNEYRALAPRPFTFVSPFFSSVQPSQGPLSGGTRLTIEGTHLSAGSSVSITV
GQLPCSFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXGGTPLTVTGTNLDTIREPRIRARYGRAESLHNCTVFSTSLMVCLAPSVAHSPALL
GGGAGPDELGFVMDDVRGLLVLNKSFSYYPDPVFELLSPSGVLELKPTSPLILKXXXXXP
AAPGPGRLNYTVLIGETPCVLTLSENQLLCEWPNLTGQHKVTXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXECAGEPLFMLYCAIKQQMEKGPID
AITGEARYSLSEDKLIRQQIDYKTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXVTDGSVIALVPKQNSAYNISNSSTFTKSLSRYXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTLQK
FVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHSITDYDVRHTWKSN
Download sequence
Identical sequences ENSGMOP00000001784 ENSGMOP00000001784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]