SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001820 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001820
Domain Number 1 Region: 115-317
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.32e-61
Family DBL homology domain (DH-domain) 0.0000189
Further Details:      
 
Domain Number 2 Region: 302-446
Classification Level Classification E-value
Superfamily PH domain-like 2.41e-32
Family Pleckstrin-homology domain (PH domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001820   Gene: ENSGMOG00000001682   Transcript: ENSGMOT00000001881
Sequence length 1173
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4025:288434:317373:-1 gene:ENSGMOG00000001682 transcript:ENSGMOT00000001881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSPDSAERPISYSSTSSSASSRDSHCSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XPGRRGGGHREATAAGRQQGKHDTRGGQASTGHSEPELSPDVAERGGLGTQGPRTYVDRV
VQEILDTERTYVQDLRSIVQDYLECISNQSRLALNAENKGSLFGNIQDIYHFNRDLLHDL
ERCNTDPVAIAECFVAKSEEFHIYTQYCTNYPRSVAVLTECMRNKVLAKFFRERQESLRH
ALPLGSYLLKPVQRILKYHLLLHEIANHMEKDTETYEVVQEAIDTMQRVAWHINDMKRKH
EHAVRLQEIQSLLTNWKGPDLIGYGELVLEGTFRLQRAKNERTLFLFDKLLLVTKKREEM
YTYKAHILCCNLMLVEIIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRMWILHLKRLILE
NHPAKIPAKAKQAILEMDAMHHPGFHFSPDGEKKASPQTRDGPSPRRARRKGRTSPWTHV
TTTNTATVHTESSSNDISGSSSAEQLTTDDIDNVYDNISYEDLKSMGLVRRDEEGRPSRR
DLSVDKGLQAQDGLVVPESLKEPGRPSESQLPGGSPELKIVEEENIYDTLCFREPPRAEL
QGGDALLASEPEFSDGLGGFVSEESLHFGEDEGLCASGAMRCSSEPDYSSSSASECFVQH
SRTGDKMSERVDEIWNDLENYIKVNEKKADRLPAAFPVGSGEAPRWPSSAKSSPTRTAPP
PAAGSATKSPPAQHLDPPVTSTAATPSFTIPIINIPDPLWPATRESQLQDLHGLFPGELA
GLGAPLASSSLLLGESVDFPLDLMDKTKNRVFLMARQYSQKIKKANQLLRMRSMDPGDAC
GRSRDEKRQMDLAAILEEKKQGGAAIGARIAEYSHLYDQVMFPLGPPRPRHPGLPSSPSM
PERSLEDDWLHSTYSNGELASFVAWPNEMASARASSTPQLRLSPACSVPALRTHPAPPPS
PPQRWSSCMSAPSEKEEEHVYSTIKRHPPPADSTKTPEHSRCRSTGSLGDRDQDAPGFGS
PGPTRVGPHSPPLGWAGRQSSLPERASCRSGLTLQDRQQVVVLHRQSALSILAATHNYLA
NFKDDGDDDDDYVEIRSEDECEGERSGGRHRRAGGPVQTQSLPCTPVRSCQPLSSVGREN
LERYLWSEPQENQPTLGRALREKFQCLSSSSFA
Download sequence
Identical sequences ENSGMOP00000001820 ENSGMOP00000001820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]