SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001862 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001862
Domain Number 1 Region: 300-427
Classification Level Classification E-value
Superfamily Second domain of FERM 1.24e-29
Family Second domain of FERM 0.002
Further Details:      
 
Domain Number 2 Region: 429-532
Classification Level Classification E-value
Superfamily PH domain-like 6.52e-23
Family Third domain of FERM 0.0061
Further Details:      
 
Domain Number 3 Region: 211-281
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000161
Family Ras-binding domain, RBD 0.077
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000001862
Domain Number - Region: 26-36
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00759
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001862   Gene: ENSGMOG00000001729   Transcript: ENSGMOT00000001924
Sequence length 1264
Comment pep:novel genescaffold:gadMor1:GeneScaffold_918:75134:108980:-1 gene:ENSGMOG00000001729 transcript:ENSGMOT00000001924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AARMDVFSFVKIPKLPGHRTKASGWPPPPPPPPPGPWGSAQGPPNGWDMGASREGRDCYI
NLLSHCGSLEEVCLEGDRFVAPAPRKVEMRRDPVLGFGFVAGSEKPVVVRSVTPXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXETVKDNSLLFMPNVLKVYLENGQTKSFKFDHNTSIKDVIST
LQEKLSIKSIEHFSLMLELRAEGSASKLMLLHEQEMLAQVTQRPGAHKMKCFFRISFVPK
DPLELLRRDCVAFEYLYVQSCNDVVLERFGSELKYDTALRLAALQMYILTISTKQSQKVS
LKYIEKEWGLALFLPPAVLSSMKEKNIKKALTHVLKTNQNLVPPGKKLTALQAKVHYLKY
LSDLRLYGGRVFKSILVQGEKHTEVTLLVGPRYGISHVINPKTNLVALLADFSHVNRIEM
YAEDEKMVRVELHVLDVKPITLLMESVDAMNLACLTAGYYRLLVDSRRTIFNVARSGAEN
AEASKSQNEKVVSNRPFSFPGHEARVKQNYRAIEWTYSTPYKAAEDRGCGQRCGPDFSNH
RECHDYQGERGRCEEIHQPQHTVHMAHRVERCRTPLPQPYLGAPRPKPQDSARNAKVSFI
FGDPPLDSVNPQNLGYQRLMDEQAEAMDNHSPMYGRLEEEYRLMEDGAEDVGGYRYAGKI
FGPRECIEEPLLRDICYAETTDDAEDDDDVSCEEDAFMSDVEKPTFLSLSGSIDDIIDLT
SLPPLPEGGDEEDSDVLLHSLNLAIAAPPPGFRDSSDEEEHQQGPGPPAQGAPNDIPVSL
IDSVPTQRTTGPGEPLDDAVVSTLRALEQLAASEDQSPEQSAGVDISRAFSPESSSDSGN
ETNSSEMTESSELASAQRHSESHLRMVHIAEGYHGRSEEKAEFITPAERGAEDVDYNSQV
PREEEEEAKSSAVASSQILHSDGGEMEPETMETKSLTDYFSKMHMGSVMNRQSGTLREGD
PSQPSDSSNGPFKELHKEELPHLVGRYNGFTARDSHYMNQMDLGRTHPREKQQPWQRAPG
TKMSDPLDSQSSHAGVLTERGEERCQPLIARQRSPSEAPGDASGPQGGEQHSIKARPPEH
DGQRLYDYHLSKRMSSLQSEGGAHSLQNSQCSSVDAGCSTGSSCCATPMDSPLCAESNTR
PLRAPGGGACAAAEEKMCGAAGQGRSGTPLDPTLLRKSHTAEPGYGTLREGSGHRGPKIK
ETTG
Download sequence
Identical sequences ENSGMOP00000001862 ENSGMOP00000001862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]