SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001930 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001930
Domain Number 1 Region: 194-469
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.88e-54
Family FCH domain 0.0035
Further Details:      
 
Domain Number 2 Region: 2-76
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-19
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 3 Region: 70-107
Classification Level Classification E-value
Superfamily WW domain 0.000000000139
Family WW domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001930   Gene: ENSGMOG00000001812   Transcript: ENSGMOT00000001993
Sequence length 471
Comment pep:novel genescaffold:gadMor1:GeneScaffold_673:24941:72074:-1 gene:ENSGMOG00000001812 transcript:ENSGMOT00000001993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGCYCKSLYPFSGDQHQQGLTFEAGDRIKIVQALPGGWWEGEKDGATGWFPSSYVQVLE
RTSSLSQLPMEDLKEPLPPQWRCYMSPQGRRYYVNTSSNETTWERPSSAPGTPKSSMRHK
NSLPAVNGFHSGGSPLHHPEHNLLVRKTSNELQNPGSVSPTRKQSKETTVTINCVTFPLP
MSMAEQPLLKPDEWSYCDYFWMDKKEPQGGCVSGFEVLLQKQLKGKQMQKEMAEFVRERI
KIEEEYARSLSKLSQIPLAGQEEGTLGKAWAQLKKSLADEAEVHLKFSSKLQSEVEKPLL
SFRDNFKKDMKRFDHHIADLRKQLIGRYAAVEKARRALADRQKDLEVKSQQLELKLSNKT
EEDIKKARRKSTQAGDELMRCVDLYNQSQSKWFEEMVTTSLELERLEVERIEMIRQHLCQ
YTTLRHETDMFNQSTMEPVDQLLQGVDPGRDRELWVNENQTGEIRPVDIEI
Download sequence
Identical sequences ENSGMOP00000001930 ENSGMOP00000001930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]