SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001958 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001958
Domain Number 1 Region: 59-179
Classification Level Classification E-value
Superfamily EF-hand 2.27e-24
Family Calmodulin-like 0.0055
Further Details:      
 
Domain Number 2 Region: 419-499,533-543
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 9.68e-19
Family Ferredoxin reductase FAD-binding domain-like 0.01
Further Details:      
 
Domain Number 3 Region: 550-735
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 0.000000000000629
Family Flavohemoglobin, C-terminal domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001958   Gene: ENSGMOG00000001828   Transcript: ENSGMOT00000002021
Sequence length 735
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2645:1399:24174:1 gene:ENSGMOG00000001828 transcript:ENSGMOT00000002021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAKERAAERCSGRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSFF
AERFFALFDSDGSSSISLDELLGALNLLIHGSEADKLRFLFQVYDVDGSGSGSIDPDELR
TVLKSCLRESAISLPEEKLDDLTLALFESADKDRSGAITFEELKAELENFPEVMENLTIS
AANWLKPPEAEERRRQAPRYLTRAYWQNNSRKLTFLMAYALLSLLLFSSALLHHRGGGVC
YMVAKGCGQCLNFNCTFVMVLMLRRCLTWLRATWLVRVLPLDQNILLHQIVGYAILVFTV
VHTSAHILNFGTHXXXXXXYSLWEYLLTTRPGVGWVRGSASLTGVVLQLLIGLMVLCSST
FVRRSGHFEVFYWSHLSYVWVWSLLVVHCANFWKWFLVPGLVFLLEKVLGLAFAHMGGLY
IVEVNLLPSKVTHLVIKRPPFFTFKPGDYLYINIPDIATYEWHPFTISSAPEQSDTLWLH
IRSMGQWTNRLFEFFRQPETLASSPKRLATSLRNKRLSQRXXLGDNHQLCNIKCYVDGPY
GTPTRQIFASEHAVLIGAGIGITPFASILQSIMYRYRRRKQNCPNCSYSWCENIIDSDMK
LRKVDFIWINRDQKSFEWFVSLLTKLEMDQADEEPEGRFLEMHMYMTSALSKNDMKAIGL
QMALDLLAKKEKRDSITGLQTRTQPGRPDWAKVFQKVSEENKGKVHVFYCGAPALAKTIK
AQCEHFGFHFYKENF
Download sequence
Identical sequences ENSGMOP00000001958 ENSGMOP00000001958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]