SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001993 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001993
Domain Number 1 Region: 2-174,216-287
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4e-34
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 994-1216
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-31
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 3 Region: 703-858,898-924
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.91e-25
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 4 Region: 413-643
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.61e-23
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000001993
Domain Number - Region: 1223-1302
Classification Level Classification E-value
Superfamily EF-hand 0.00169
Family Polcalcin 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001993   Gene: ENSGMOG00000001806   Transcript: ENSGMOT00000002058
Sequence length 1671
Comment pep:novel genescaffold:gadMor1:GeneScaffold_88:280:39740:-1 gene:ENSGMOG00000001806 transcript:ENSGMOT00000002058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PFDIFILLAIFANCVALGVSKPFPEDDSNSTNHDLEQVEYIFLIIFTIETFLKILAYGLV
MHPSSYIRNGWNLLDFVIVIVGLFSVVLETVTHKSGEVSTTSHHTPGKPGGLDVKALRAF
RVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCY
NYVEDDPVPCAFAGHGRQCTLNGSECRGRWDGPNGGITNFDNFFFAMLTVFQCITMEGWT
DVLYWMNDAMGLELPWVYFVSLVVFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLRE
KQQMEEDLCGYLDWITQAEDLDENLDDNHXXXXXXXXXXXXXXXXXXXXXXXXXXASLPA
SETGSETTENIEDEHTNCCQACXXXXXXXXXXRVLKRWNRVCRRRCRVAVKSVTFYWLVL
LLVFLNTSLSASEHYDQPDWLTGVQDTANKVLLSLFTVEMLLKMYSLGLAHYFVAFFNRF
DCFVVCGGIMETILVELGIMPPLGISVLRCVRLLRIFKVTRHWTALSNLVASLLNSMKSI
ASLLLLLFLFLIIFALLGMQLFGGKFNFDETQTKRSTFDAFPQALXXXXXILTGEDWNMV
MYDGIMAYGGPVFPGMIVCVYFVILFICDILLNVFLAIAVDNLAGGDTDNKKIDVDLDTE
YEEEEEPPEGEEEKVLPIPEGSAFFCFSKTNPIRRGCHVLIHHHIFTNLILVFIILSSCS
LAAEDPIRAHSFRNNILGYADYAFTSIFTVEILLKMMVHGAFLHQGSFCRNWFNLLDLLV
VSVSLVSFFLHSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIKTIGNIMIVT
TLLQFMFACIGVQLFKGKFFRCTDEAKHTPEECKGSFVVYKDGDVTHPMVRERFWLNSDF
NFDNVLMGMMALFTVSTFEGWPALLYKAIDANGENSGPIYNYRVGEQGEQEYKNCELDKN
QRQCVEFALKAQPLMLYIPKNPVQYKFWSIINSTCFEYVMFVLILLNTVTLAIQQHYEQS
KGFSHIMDILNMVFTGLFTVEMLLKLLALRLRHYFMDAWNSFDALIVVGSVVDIVVTEFS
SGEDSSRVSITFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSLQALPYVALLIALIFFIYA
VVGMQHARVRCATGEAWQEIMLSSLPGKRCDPESDYAPGEEFTCGSSFAIVYFISFFMLC
AFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVALLRR
IQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVTFNATLFALVRTALKIKTDGIPEQENE
ELRVIIKKIWKRMKPKLLDEVIPPHKEEEVTVGKFYATFLIQDYFRKFRKRKEKDGLPGE
PEVGNASAVQLCKAGLKTLQDLGPEMRLALNQDXXXXXXXXXXXXXXXXXXXXXXLLEEG
GVSNGGLIHRVGSLSKEPAAMEDDRRRHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXQSGGYESRSVLGSSWAHPCPTRGRLLYAPLILVEEDSNSSWGGDEERRPGGGAPY
RAYSSLRVPGQLGPQRSEEGSADSLVEAVLVSEGLGLYARDPKFVAFAKREIADACHMTV
EEMESAASDLLSRKLLISHADMSLYSDEEPIRAGREEEAELADEMACVTSF
Download sequence
Identical sequences ENSGMOP00000001993 ENSGMOP00000001993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]