SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001997 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001997
Domain Number 1 Region: 8-181
Classification Level Classification E-value
Superfamily EF-hand 1.08e-49
Family Penta-EF-hand proteins 0.000000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001997   Gene: ENSGMOG00000001880   Transcript: ENSGMOT00000002062
Sequence length 185
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1975:66722:81943:1 gene:ENSGMOG00000001880 transcript:ENSGMOT00000002062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYHSPYRAPPTINAPPDQSFLWNIFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVR
SIISMFDRENKGGVNFNEFAGVWKYITDWQNIFRTYDRDNSGFIDKNELKQALTGFGYRL
SDQFYGTLIEKFDRQRKGQVAFDDFIQCCIVLQRLTDVFRRYDTDQDGWIQVSYEQYLSM
VFNVV
Download sequence
Identical sequences ENSGMOP00000001997 ENSGMOP00000001997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]