SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002031 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002031
Domain Number 1 Region: 1102-1242,1309-1585
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.86e-106
Family Myotubularin-like phosphatases 0.0000045
Further Details:      
 
Domain Number 2 Region: 1731-1838
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-26
Family Pleckstrin-homology domain (PH domain) 0.0000118
Further Details:      
 
Domain Number 3 Region: 879-1019
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000697
Family GRAM domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002031   Gene: ENSGMOG00000001854   Transcript: ENSGMOT00000002098
Sequence length 1840
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3298:471792:567457:-1 gene:ENSGMOG00000001854 transcript:ENSGMOT00000002098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARFADYFIVVGYDQDKSGSEEGCGKIIQRFPKKDWEGTAFPQGVEMFCQPGGWRLSRER
RAPTFFTVVLTDIESDRHYCSCLTFFEAEVNLQGSKAIDGDGDEDEEEDGMVQPAQVFAP
KSLILVSRLDFPEIFRGCLGLIYTVYIDSLSFPLEGLVANLFIFQVPVAGGSQKLFSLGA
GDRQLIQTPLNDSLPVTSKSVALLFQQLGIQNVLSLFCAVLTEHKVLFHSTSYQRLGEAS
RALEALMFPLKYSYPYIPILPSRLLEVLSSPTPFIIGVHSMFQTEIQDLLDVIIADLDGG
TIKIPECIHLSLLPEPLLTQTQTALSLVLHPDLEIADNAFPPPRTALSNLKLLDKEVRAV
FLRLFAQLFQGYRSCLQLIRIHSEPVIHFHKTAFLGQRGLIENDFLTKVLDGMAFAGFVS
ERGPPYRACDLFDELVAFDVDRIREEDADPVKLQKHMRDLSEQLYKNENPNPHMAFQKVP
RPSEGSHLRVHQVPFPPLQDDKVEGLLLEAAAKHAATPAVPRPEKKCVVPAGPPVVSIMG
KSCSVFNSARRLEVVRSCISFVFDNNNLETEKSLPAALRALKGKAARQCLTEELCLHVRQ
NRAILDHQQFDYIIRMMNCALQDCSSSEEFTVAAALLPLSTEFHRAGVKQYAYTCVQDHP
IWTNQQFWEATFYSEVQNKIRSLYLSSAEEKVGITARLKDAGPQAAAGLGRAEEHTAMDL
AAEQLRAWPCLSKQKQQELVKNEESTVFGWAIHYASLMVYLLVPLDTSKNKLLRNHPATD
WESGSNSIVTNSMAGSVAESFDTESGYEDSESSDAANSVVRFIVRFIDKVCTESGVTQEH
IKSLHNMIPGLVAMQIEVLETVHRESRRLPPIPKPKILRPTLLPGEELVSEGLRVVLDPD
GREEATGGLLGGPHILPAEGALFLTNYRVIFKGTPHDLGEQPVIRAFPVSTLVKEKKISL
QNQLQQNMQEGMQLRSASFQLIKVAFDEEVTSEMVEIFRKHVQRIRYPQSIFSSFAFAAG
QAALQLSHPKQKEKNTGFRTLSKSIVKGARKAGKITMGRGGQTTLKKSERGSRMTWNDDD
DISISDDGEPPPSSTLRASEKSTMEQLVERACFRDYQRLGLGTITLSASRTKTGEQFRIT
AANRLYSLCRSYPGLLVVPQAVQDSSLHKVARCYRHNRLPVVCWKHPRSKALLLRSGGFH
GKSVVGLFKSQNPSTTTTTSSSESSSSLEQEKYLQAILDSVPVHFKMNGNNTLSNRSQIG
LSPGVWASLRSSSRPSQLQSPGEQGARIAGKDLAPPAGSSGLQAQLLKQQAAFYIFGEKS
HLRGLKMDSSLNCELVPVDFADTRQVKAAFKKLLRACVPSATSSDAEDSFLRALEESEWI
SQLHKILELALLLVDLLDTGSSVLLSLEDGWDITTQVVSLVQLLSDPFYRTLEGFQVLLE
KEWLSFGHKFSQRSNLSPGSQGSGFTPIFLQFLDCVHQLLDQHPLEFEFNQQYVKFLAYH
HISNRFKNFLLDSDYERLEHGTLFEDKGDKQARRGVCIWEWINRMHRKSPVFFNYMYRPS
ETEPTLKPVIINIPSLAKWDFFTDETLSTGPAYDCRMMASRGDGADEADTISTSRRRIVW
PCYSSVSRAQPDAITQLLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRKQSLSL
SGLIPTSGLQAFQRRSMMHLPDSGLGEDRSAVTPNGVRRAATLYHQFTPKNDENRSYEGI
LYKRGALLKGWKPRWFVLDVTKHQLRYYDTGEDTNCRGHIELAEVESVVIAAPTIGAPKH
ISEKAFFDLKTSKRVYNFCASDAPTALVWMDKIQSCISDA
Download sequence
Identical sequences ENSGMOP00000002031 ENSGMOP00000002031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]