SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002043 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002043
Domain Number 1 Region: 4-107
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.15e-27
Family DBL homology domain (DH-domain) 0.00046
Further Details:      
 
Domain Number 2 Region: 93-214
Classification Level Classification E-value
Superfamily PH domain-like 4.82e-26
Family Pleckstrin-homology domain (PH domain) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002043   Gene: ENSGMOG00000001924   Transcript: ENSGMOT00000002110
Sequence length 230
Comment pep:novel genescaffold:gadMor1:GeneScaffold_813:174:35557:1 gene:ENSGMOG00000001924 transcript:ENSGMOT00000002110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFLPSSMAVLRECMQDERLLVFFQERQATLNHSLPLETYLLKPVQRILKYHLLLQELSKH
WDHGPGHEVVEDAIVAMTAVAWYINDMKRRQEHAIRLQEVQGLLVNWVGPELGGFGELVL
EGCFRVLRMRKERAFFLFNNMLLITKKRMDRFIYSTHIFCCNLLLVEHLKDPLTFKVSDQ
TIAKEQHTVQTRNLEEKRLWIHYLKRLIMENHPTSLPHKARQVLGDNFCQ
Download sequence
Identical sequences ENSGMOP00000002043 ENSGMOP00000002043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]