SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002074 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002074
Domain Number 1 Region: 1195-1350,1390-1466
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.51e-40
Family Voltage-gated potassium channels 0.023
Further Details:      
 
Domain Number 2 Region: 1517-1713,1741-1766
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.49e-38
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 3 Region: 83-228,310-377
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.69e-32
Family Voltage-gated potassium channels 0.018
Further Details:      
 
Domain Number 4 Region: 713-941
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.1e-29
Family Voltage-gated potassium channels 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000002074
Domain Number - Region: 1775-1820
Classification Level Classification E-value
Superfamily EF-hand 0.064
Family Calmodulin-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002074   Gene: ENSGMOG00000001923   Transcript: ENSGMOT00000002141
Sequence length 1989
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4552:3:88568:1 gene:ENSGMOG00000001923 transcript:ENSGMOT00000002141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDDEPRPNGDLEAGKSLPFIYGDVPPRLVSTPLEDLDSFYCNQKTFIVLNRGKALFRFNA
TPALYILSPFNPLRRISIRVLVHSMFSVLIMFTILTNCAFMTLSNPPDWAKNVEYTFTGI
YTFESLIKILARGFCVGKFTFLRDPWNWLDFSVILMAYVTEFVDLGNVSALRTFRVLRAL
KTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRQKACVSRSGT
TPLSTNSLLTTNDSLALNGTFNWTEYMNNDSNYYSLPNRRDPLLCGNGTGAGLCPEGYIC
LKVGRNPDYGYTSFDSFSWAFLSLFRLMTQDYWENLYQQTLRAAGKPYMIFFVLVIFLGS
FYLVNLILAVVAMAYDEQNQATIEENQQKEEEFQAMLEQLKRQQEEAQVAAAAAAAGPEE
ESGEYSERGAVTSESSSLASKLSSKSAKERRNRRKKRRQREEEEERGRRGTVRKSESEDS
IKRSSFRFSIDANRLTYEKRCSSPNQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXANGKMHCAVDCNGV
VSLVAGAAGGAASATAPGRLLLPHEGTMTMDTELKKRCSSFRKASMDFLEEPGARQRALS
IASILTNTMEELEESRQKCPPCWYKFANSYLIWDCHPTWLRFKEVMNMVVMDPFVDLAIT
ICIVLNTLFMAMEHYPMTIEFNNVLSVGNLVFTVIFTAEMCFKIIALDPYYYFQQGWNIF
DSIIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTL
VLAIIVFIFAVVGMQLFGKSYKECVCKIHADCKLPRWHMHDFFHSFLIVFRVLCGEWIET
MWDCMEVDGQSVCLIVFMMVMVIGNLVVLNLFLALLLSSFSADNLAATDEDSEMNNLQIA
VGRIQRGIAFFKAAMRKFLRRICFDGVAGRGKDQAMPLESKTVEELQSNGKGNCISSNHT
AVEVITKEPSPAGEYLKEGNGRPGWGGVLGVRVSDGGDNSPMEKYPVEDCDYMSFIHNPV
LTVTVPIAVVESDFENPNTEEFSSDSSDVEGSTEPGQKIDIEPRPPSSSEGSTVDIRPPG
EGCESEEMEPEESMDPAACFTGCVRRFQCCQVSVEEGWWKSWWTLRKTCFIIVEHNWFES
FIIFMILLSSGALAFEDIYIEQRRTVKTMLEYADKVFTYVFILEMLLKWVAYGFVKYFTN
AWCWLDFLIVDVSIVSLVANALGYSELSAIKSLRTLRALRPLRALSRFEGMRVVVNALLG
AIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYYYCVNTTNDEVFPIDVVNNRSECLALVND
SARWKNVKINFDNVGAGYLALLQVATFKGWMDIMYAAVDSRNLEDQPEYEVNLYMYLYFV
IFIIFGSFFTLNLFIGVIIDNFNQQKKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXNAFQGFVFDCITKQAFDIVIMILICLNMVTMMVETDDQGVDMDWVLYWINLVFIVLF
TGECVLKMVSLRHYYFTIGWNVFDFVVVILSIVGMFLSKVFEKYLVSPTLFRVIRLARIG
RILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKHESGIDDM
FNFETFGNSMICLFQITTSGGWDTLLAPILNKREPDCDSQLEHPGNPNKGNCGNPSVGIL
FFVSYVIICFLIVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWERFDPDATQFIE
YARLSEFADALDPPLRMPKPNKIQLIGMDLPMVSGERIHCLDILFAFTKRVLGEGGEMDV
LRGQMEERFMASNPSKVSYEPITSTLRRKQEDTSARMIQRAFRCHRVRLAMKRASKLYKE
QLAVGVRDPDKDVVVFGLPEESSERSNKTDLTLSTASPPSYNSVTKSAKYEQGDSEKENM
GMDSRGRRQ
Download sequence
Identical sequences ENSGMOP00000002074 ENSGMOP00000002074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]