SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002194 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002194
Domain Number 1 Region: 11-169
Classification Level Classification E-value
Superfamily EF-hand 7.78e-35
Family Calmodulin-like 0.0000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002194   Gene: ENSGMOG00000002061   Transcript: ENSGMOT00000002264
Sequence length 171
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3599:72012:72999:-1 gene:ENSGMOG00000002061 transcript:ENSGMOT00000002264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQTESIDDEEITLQDIQELYRKFAFECPSGNLHLHEFKRIFGVNCTSRAEEASYMENVF
RSFDTNQDNKIDFMEYVAAIHLVLRGKLEDKLKWSFKVYDSDGNGCLDRREVKHVLTIIY
MLKKHNNPAPQAKVEDICDRIFELVDVNNDRISLEEFMEGAQKDPWVMEQL
Download sequence
Identical sequences ENSGMOP00000002194 ENSGMOP00000002194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]