SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002237 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002237
Domain Number 1 Region: 14-184
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-49
Family DBL homology domain (DH-domain) 0.00033
Further Details:      
 
Domain Number 2 Region: 342-519
Classification Level Classification E-value
Superfamily PH domain-like 2.4e-20
Family Pleckstrin-homology domain (PH domain) 0.0000562
Further Details:      
 
Domain Number 3 Region: 170-286
Classification Level Classification E-value
Superfamily PH domain-like 5.25e-18
Family Pleckstrin-homology domain (PH domain) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002237   Gene: ENSGMOG00000002085   Transcript: ENSGMOT00000002311
Sequence length 522
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4109:69659:104034:1 gene:ENSGMOG00000002085 transcript:ENSGMOT00000002311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFRDAVAKATRQNGKPVVEERVLSQILYYLPQLYQLNRDLLRELEDRVAHWADHQRLADI
FVQKGPYLKMYSTYIRQFDNNVALLDEQCRKNPAFVAVVREFETSPRCASLALKHYLLKP
VQRIPQYQLLLTDYLKNLPEDSEDYKDTQAALSIVKEVANHANDIMKQGDNFQKLMQIQY
SLNGHHEIVQPGRVFLKEGTLMKLSRKEMQPRMFFLFNDALMYTTPVQSAQYKLNSVLSL
AGMKVSKPSQEAIQNELNIEGVECSFILSASLATERWLKAIAKAIDDSTKKKVTFISSRS
QDEPDVVPDIGAPLGSKAPVWTPDLRATMCTMCTCEFTLTWRRHRGRACGKVVCQACSTN
KFYLEYLKNQPARVCDHCFTKLQENSDRCASTSVSPIGKSAAFSFSRKHKKIPAALKEVS
ANTENTSMSGYLNRSKGSKRQWKRLWFVIKDKVLYTYAASEDVAALESQPLLGFFLREEK
YGPAQRQQFKLYHKNTLFYIFKADDIPSAQRWIEAFQEAMIL
Download sequence
Identical sequences ENSGMOP00000002237 ENSGMOP00000002237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]