SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002281 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002281
Domain Number 1 Region: 97-278
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-31
Family DBL homology domain (DH-domain) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002281   Gene: ENSGMOG00000002121   Transcript: ENSGMOT00000002357
Sequence length 659
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2794:78:13503:1 gene:ENSGMOG00000002121 transcript:ENSGMOT00000002357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRQRASLELLESERVYVSYLSLLL
KANISFNGSEAPGPKDQRXVFPSSLRFLIQQHLHLLHTLQERVLKSQWQGIMGDVFMKLT
SKESDFLDLYLSYLKELPDCLALVGLLTASAHTAALLECEGDESRPSLQSLLIQPVQRIP
QYTLLLQALLRQTEVDHPDYFLLLVSIQQFRSFTAQNQDLLXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXDHVTQVKRSKQRLLEQIQSRTRTPYQDYQDYQD
WGRDPDRYPRDRCGPLPYFSPDPEPRTAKPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCVSPDEAVLRRHSPQRPLQAG
QRKSKSLNGLQLDSTVSCVDAGPDHGHRGLERQGSSKGCPTPTRRGPVHLGSSPHSLEPE
LHISIPQVLYTNDPAAQAWGEEPRWRGGAEEISHTPLSERGRKQEKGGFRSSFKRLFKK
Download sequence
Identical sequences ENSGMOP00000002281 ENSGMOP00000002281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]