SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002378 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002378
Domain Number 1 Region: 186-461
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.7e-73
Family Mitochondrial carrier 0.00012
Further Details:      
 
Domain Number 2 Region: 16-163
Classification Level Classification E-value
Superfamily EF-hand 5.57e-35
Family Calmodulin-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002378   Gene: ENSGMOG00000002224   Transcript: ENSGMOT00000002458
Sequence length 468
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1054:24003:34251:-1 gene:ENSGMOG00000002224 transcript:ENSGMOT00000002458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGQCQENQESPELRRRRRWARLFDQLDLNKDGRIDLRELRVGLAKRGVSRSSVDKVVLAG
DTNQDGELDFEEFSRYLHTHEKQLRLLFSNLDRNHDGEIDAAEIQHSLRSIGLDVSRQEA
ERILSRMDRDGTMTIDWAEWRDHFLFNPLHNMEDVARYWRHTMMFNIGEHHTVPDEFSER
EHRSGTVWRQLMAGASAGAVSRTVTAPLDRLKVFLQFHSLSFKALHNFRSKVIIQEGGVF
SLWRGNGINVLKIAPETAIKFMVYEQIKCRIRSSREGGALRVQERFVAGSLAGVSAQTLI
YPMEVLKTRLTLRRTGQYRGIADCAGQILRKEGVLAFYRGYLPNMLGIIPYAGIDLAVYE
TLKNAWLQRYSKGSADPGVLVLLGCGTVSSTSGQLASYPLALVRTRMQAQATCEGQPRLS
MLGQFKHIMFHEGVPGLYRGLAPNFLKVIPAVSISYVVYEHMKKILGV
Download sequence
Identical sequences ENSGMOP00000002378 ENSGMOP00000002378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]