SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002405 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002405
Domain Number 1 Region: 153-311
Classification Level Classification E-value
Superfamily EF-hand 7.72e-29
Family Calmodulin-like 0.036
Further Details:      
 
Domain Number 2 Region: 47-182
Classification Level Classification E-value
Superfamily EF-hand 2.93e-19
Family Calmodulin-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002405   Gene: ENSGMOG00000002271   Transcript: ENSGMOT00000002485
Sequence length 317
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2425:100159:104007:1 gene:ENSGMOG00000002271 transcript:ENSGMOT00000002485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEMELRPLVMCFALCVVYATSKPTEKKDRVHHDELLSNRDHDDGDNFDYDHEAFLGQEEA
KTFDQLTPEESKERLGMLVERIDEDKDGFVSVEEMKRWIKHAQKRWIYDDVDRQWTGHDL
NGDGLVSWEEYKNATYGYILDDPDPEDGFSYRQMMSRDERRFKMADLNTDGKANKEEFTA
FLHPEEYDHMKDIVVLETMEDIDKNGDGFIDLDEYIGDMYNQEGDPSEPEWVKTEREQFT
EFRDKNKDGKMDKDETRDWILPSDYDHADAEAKHLVYESDTDKDGVLTREEIVDKYDLFV
GSQATDFGEALARHDEF
Download sequence
Identical sequences ENSGMOP00000002405 ENSGMOP00000002405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]