SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002452 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002452
Domain Number 1 Region: 126-510
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.86e-139
Family Myotubularin-like phosphatases 0.0000000294
Further Details:      
 
Domain Number 2 Region: 6-117
Classification Level Classification E-value
Superfamily PH domain-like 4e-19
Family GRAM domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002452   Gene: ENSGMOG00000002292   Transcript: ENSGMOT00000002533
Sequence length 658
Comment pep:novel genescaffold:gadMor1:GeneScaffold_600:31926:46690:1 gene:ENSGMOG00000002292 transcript:ENSGMOT00000002533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHIRTPKVEQVRLLDRFSSKSTSGTLYLTATHLIFVESSPSSPSSAAQEIWVLHHHIAS
VEKLSLTTTGCPLVIQCRNFRVVHFVLQRERDCHDIYSSLLRLLRPVAYEELYAFSYNPK
QNDQQREEGWQLIDLGAEYERMGVPCDQWQLTDVNRDFKVCETYPRDLYVPITANKPIIV
GSSKFRSKGRFPVLTYFYQEKKAAVCRCSQPLSGFSARCLEDESMLQAISKANHNSRFVY
VMDTRPKLNALANRAAGKGYENEDNYSNIRFQFVGIENIHVMRASLQKLLEVIGNRSLSM
SDYLMGIEGCGWLRHVKAVVDAAIFLTKAVTVEGASVLVHCSDGWDRTAQVCSLGALLMD
PYYRTIKGFMVVLIEKDWISFGHKFADRCDQLDGDPKEVSPVFTQFLECVWQLTEQFPQA
FEFSEWFLLQIHEHVHSCQYGNFLGNNQRQREELQLREKTHSLWAFLMEEQQNYQNPFYS
SVYGKTHPVLEPSTLPYHFKFWRNMYHQFDRSMHPRQSILKTIHTLKETSLKSAQTLRAL
ENELQQLGVTPVVTSAPPPPPSREQQQRSLTNARPPRPNSLILGAPQVSRKEAQQDEEKQ
QQATESTDTDRTVEGSSGTDSRKQSYGELEGSYEDGDEMTKEEPAVVSLEFGMARMTC
Download sequence
Identical sequences ENSGMOP00000002452 ENSGMOP00000002452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]