SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002470 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002470
Domain Number 1 Region: 236-435
Classification Level Classification E-value
Superfamily MIR domain 3.75e-64
Family MIR domain 0.0000000135
Further Details:      
 
Domain Number 2 Region: 438-602
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 8.5e-59
Family IP3 receptor type 1 binding core, domain 2 0.0000000498
Further Details:      
 
Domain Number 3 Region: 1121-1278
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 4.45e-35
Family IP3 receptor type 1 binding core, domain 2 0.0078
Further Details:      
 
Domain Number 4 Region: 107-219
Classification Level Classification E-value
Superfamily MIR domain 1.44e-19
Family MIR domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000002470
Domain Number - Region: 2316-2448,2508-2580
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00204
Family Voltage-gated potassium channels 0.023
Further Details:      
 
Domain Number - Region: 2671-2718
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0445
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002470   Gene: ENSGMOG00000002239   Transcript: ENSGMOT00000002551
Sequence length 2736
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2470:59105:173802:1 gene:ENSGMOG00000002239 transcript:ENSGMOT00000002551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDKMSSFLHIGDVCSLYAEGSTSGFISTLGLVDDRCVVQPDTGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGGNSTTDTVLLNKLHHAADLEKKQNESENRKLLGSVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDSAGNEGSWFYIQPFYKLRSLGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKVTLFMKWSDNKETILKGGDVV
RMFHAEQEKFLTCDDHRKKQHVFLRTTGRQSATSATSSKALWEIEVVHHDPCRGGAGYWN
SLFRFKHLATGCYMAAEVNPDFEEEPAEQRSSLDTDHEALRARLRAPQGKVMYTLVPVPD
GMEISSIFELDPTTLRGGDSMVPRSSYVRLRHLCTNTWVHSTNNPIDKEEEKPVMLRIGT
SPVKEDKEAFAIVPVPPAEVRDLDFANDASKVLASIAGKLEKGTITQNERRFVTKLLEDL
VFFVVDIPNSGQDVLEIMVNKPNRERQKLMREQNILKQIFKLLQAPFTDSGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFRFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVTLVRKNQEPRFLDYLSDLCVSMNKSIPVTQELICNAVLDPA
NADILIETKLVLSRFEIEPAAIGESPSLEAEDEEEVWLFWKDPSKEVRSKSIRELAQDAK
EGQKEDQEVVSYYRYQLNLFARMCLDRQYLAINKISGQLDVDLILRCMSDEDLPFDLRAS
FCRMMLHMHVDRDPQEQVTPVKYARLWSEIPSKIAIDDYDNDGTTRDEIKERFCLTMEFV
ENYLREVVSQNIPFNDREKNKLTFEVVNLARNLIYFGFYNFRDLLRLTKILLNILDCVHV
STIYPITKLEKEEEETKGNVMKSIHGVGELMTQVVLRGGGFLPTTPTHQPEGDVVKAQIE
PEREDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNPQGDNSTSQDGVNP
LTGNLDFENIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGALHLL
FRHFSQRQEVLMAFKQVQLLVTSQDVDNYKQIKSDLDQLRSIVEKSELWVYKRQGEDGND
GDGPAESDHKKKGDSSGSDKKKSESASCYNYRVVKEILLRLSKLCIQEGASGKKTRKQQQ
RLLRNMGAHSVVLELLQIPYEKGEDVRMEEIMKLAHEFLQNFCAGNQQNQILLHKHINLF
LNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCTETHGRNVQYLKFLQTIVKAENKF
IKKCQDIVMAELVNSGEDVLVFYNDRASFQTLVQMMRSERGRMDENSALMYHIHLVELLA
VCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEIKVAYINFLNHCYVDTEVEMKEIYT
SNHMWKLFENFLVDICRVCNNTTDRKHADTMLEGYVTETVMSIVTCFFSSPFSDQSTSLQ
TRQPVFVQLLQGVFRVFHCNWLNPVQKASVEACIKVLSDVAKSRAIAIPVDLDSQVNNLF
VKSNNVVQKSILNWRLSAKNTSRKDSDLPSSKDYRNIIERLQDIVSALEDRLRPLVQAEL
SVLVDVLHRPELLFPENTEARKKCESGGFISKLIKHTKQLLEENEERLCIKVLQTLREMM
TKDRGYGEKLIAFDDEMDVAELAPPPEPEVPIEDLDPSQPQKQLEDQTRGEALRQILVNR
YYGNLKPSGRRDSVTTFSPSPLSPTAQGKPTTVVSSGVGGRAELSLAEVQCHLDREGASD
LVIDLIMNATSDRIFQESILLAIALLEGGNTVIQRSFFARLTGDNKSEKFFKVFYERMKL
AQQEIKATVTVNTSDLGSKKKEEEPPDKDAVARKKVVVVAVASEDIKEQLVEATLTTKKA
FTTYRREAEAEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
NFLRNQNNKNNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVGLINQTLESLTEYCQ
GPCHENQNCIATHECNGIDIIIALILNDINPLGKKRMDLVLELKNNASKLLLAIMESRHD
SENAERILYNMRPKELVEVIKKAYMHSASPRNVGHNIYILAHQLARHNKELQAMLKPGGT
YGEGDEALEFYAKHTAQIEIVRLDRTMEQIVFPVPNICEFLTTESKLRVYYTTERDEQGS
KINDFFLRSEDLFNEMNWQKKLRAQPILYWCSRNMSFWSSISFNLAVLMNLLVAFFYPLE
GIRRGTLDPHLSALLWTAMLVSLAIVIILPQPHGIRAFIASTILRLIFSVGLEPTLYLLG
AFNVCNKVIFLMSFVGNRGTFTRGYKAMIMDVEFLYHLLYLIICSLGVFVHVFFYSLLLF
DLVYREETLLNVIKSVTRNGRSIVLTAVLALILVYLFSIVGYIFFKDDFILAVDRIPNKT
LGAEHGASMVGELFSGGACLKENGENCSAEASVDAAVVAPQPSPLVIEDKERVCDSLIMC
IVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFA
DLRSEKQKKEEVLKTTCFICGLERDKFDNKTVTFEEHIKVEHNMWHYLFFIVLVKVKDST
EYTGPESYVAEMIRDHNLDWFPRMRAMSLVSSDADGEQNEIRNLQEKLESTMKLVTNLSG
QLTELKEQMTEQRKQKQRIGLLGHPQHMNANPQQPA
Download sequence
Identical sequences ENSGMOP00000002470 ENSGMOP00000002470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]