SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002481 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002481
Domain Number 1 Region: 16-218
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-42
Family DBL homology domain (DH-domain) 0.00089
Further Details:      
 
Domain Number 2 Region: 210-289
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000985
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002481   Gene: ENSGMOG00000002343   Transcript: ENSGMOT00000002562
Sequence length 301
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3964:6200:41006:-1 gene:ENSGMOG00000002343 transcript:ENSGMOT00000002562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFSPGVNDPSGASVIQEQRDRWARKRSRVARELVLTEQRYCQQLELVNTYFVEILKAKE
TLRPSVVESVFSSIKAIHSVNQSLLVHVENGYLGRGFEQFCPQLPHYNVYVDNMYDARKV
LAAQLKKNRGFRRYKALQEARPEFRDCKLEDLLNLPAQRIHQYKHYLQDLTETTSPEDPE
FQQLSGAARAVSEVSCRIQDNARSHQNHLQLLRVQRLLKGRRTKVLAPGRWFIREGWLRR
VPTKGVEATPRMFFLFSDMLVQAKLRPPHGGKFSGQHAYPLQDCTVDKVFGHTRSQGGLL
S
Download sequence
Identical sequences ENSGMOP00000002481 ENSGMOP00000002481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]