SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002486 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002486
Domain Number 1 Region: 5-188
Classification Level Classification E-value
Superfamily EF-hand 8.65e-55
Family Calmodulin-like 0.0000000574
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002486   Gene: ENSGMOG00000002354   Transcript: ENSGMOT00000002567
Sequence length 196
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2112:250905:253265:1 gene:ENSGMOG00000002354 transcript:ENSGMOT00000002567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPEAMGKQNSKLRPEIMQDLVENTDFKETEIQEWYKGFLRDCPSGALSMEEFKKIYGNFF
PYGDASKFAEHVFRTFDANNDGTIDFREFIIALSVTSRGKLDQKLKWAFSMYDLDGNGYI
SKAEMLEIVTAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNRDGKLSLEEFVEGARND
PSIVRLLQGDPSSSGQ
Download sequence
Identical sequences ENSGMOP00000002486 ENSGMOP00000002486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]