SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002507 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002507
Domain Number 1 Region: 6-119
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000256
Family V set domains (antibody variable domain-like) 0.021
Further Details:      
 
Domain Number 2 Region: 230-303
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000614
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 143-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000538
Family C1 set domains (antibody constant domain-like) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002507   Gene: ENSGMOG00000002372   Transcript: ENSGMOT00000002589
Sequence length 308
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4380:88070:99946:1 gene:ENSGMOG00000002372 transcript:ENSGMOT00000002589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVDRSGYVGSKVDLRCRFLNSVPPVKISQVTWQKVVNGSKQNVAIANPSLGVSVAPAYR
DRVAFKSAAVRRRAPVLEDTTLTFSSLRLADDAAYICEYTTFPAGNREGTVNLTVYARPT
TKMSLSTPTLVARANNVRTPVATCTSANGKPPAIIRWETRVPGEATSTEFRNSDGTFTVQ
SEYAMVPSKDTHQEVLTCVTTYNDEVFTDSVTLDIQYEPDVSVEGFDGNWYLNRENVQLS
CQANANPRVSLYQWKRVNGTIPSNVEIQDNTLTFSGPLTYDLEGTYACEATNGIGTRAAS
VEVVIIGM
Download sequence
Identical sequences ENSGMOP00000002507 ENSGMOP00000002507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]