SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002538 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002538
Domain Number 1 Region: 346-591
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.81e-66
Family Calponin-homology domain, CH-domain 0.00000336
Further Details:      
 
Domain Number 2 Region: 91-220
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-40
Family Calponin-homology domain, CH-domain 0.000000559
Further Details:      
 
Domain Number 3 Region: 2-61
Classification Level Classification E-value
Superfamily EF-hand 0.00000000432
Family Calmodulin-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002538   Gene: ENSGMOG00000002377   Transcript: ENSGMOT00000002621
Sequence length 598
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3844:172604:185698:1 gene:ENSGMOG00000002377 transcript:ENSGMOT00000002621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNENGFICDRELTALFKEANLALPGFRIREIVQEMDRDKDNQLNFEEFIAIFTELKDDQV
ATFRKAINKKEGILAIGGTSEQSSTGTQHSYSHEECFAFTNWINSALEDDPDCAHIIPIN
PNTNALFQAVGDGIVLCKMINLSVPDTIDERTINKKKLTAFTTQENLNLALNSASAIGCH
VVNIGAQDLREGKPHLVLGLLWQIIKIGLFLDIELSRNEXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXDSRAYFHLLQQIAPNGSKEDVPQISIDMSGLSXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
PPHGETREERTFCNWMNSLGVTPHVHHIYGDLMDALVILQLYEKIKVEVDWDHRVNRPPY
PKIGHLKKENCNYAVELGKSSAGFSLVGIGGQDLNEGNPTLTLALVWQLMRRYTLNVLED
LGDGEAAGDELIVNWVNKTLKNAGKTTSLRSFKDKSISDSSPVLDLIDSIQPNSVKFDLV
KTGSLTDEDKLSNAKYAVSMARKIGARVYALPEDLVEVNPKMVMTMFACLMGRGMKRA
Download sequence
Identical sequences ENSGMOP00000002538 ENSGMOP00000002538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]