SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002572 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002572
Domain Number 1 Region: 16-481
Classification Level Classification E-value
Superfamily Sema domain 6.8e-155
Family Sema domain 0.000000000264
Further Details:      
 
Domain Number 2 Region: 540-629
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000062
Family V set domains (antibody variable domain-like) 0.066
Further Details:      
 
Domain Number 3 Region: 477-519
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000889
Family Plexin repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002572   Gene: ENSGMOG00000002408   Transcript: ENSGMOT00000002655
Sequence length 708
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1206:86812:132093:1 gene:ENSGMOG00000002408 transcript:ENSGMOT00000002655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIQNGRLLTLPLVAGDLSMLLPDEDGRRLFVALKDNLLSTSLDDITQNPRKLYWPASPDR
VQECLMAGKHPETECGNFLRVLQPYNQTHLYVCGTGAFNPRCVFIATSLFLKSDHQSLSY
GQTECGKGKCPYDPHQRTASAVVDGELYAGITSDFMSRDSAFFRSLGNRRVMRTEQYDST
WLHDAQFVRVAPLSETDNPEDDKVYVFFTERAQEAEGAAGKVLYSRVARVCKNDIGGQRS
LVNKWSTFQKARLVCSVPGADGLQTHFNQLQDIFILNGKDKKNPLIYGLFTTSSDILNGS
AVCVYRMEDMARVFKGNFLHKEGPQYKWAEFTGKVPFPRPGTCPSSTYGSYTSTREYPDD
VIFFSRTHPLLEEIVAPLGERPLLVRVGVHYKFTKLVVDRVEAVDGTXXXXXXXXXSGLV
LKSIHLPRDDGQSQEITLEELQVFKLESPVTAMTLSKKKQWLFVGSREGLSQLALYQCEL
YGQACAECCLARDPYCTWDGHACSPYMPVARRRNARHLGQEEDPLKQCVRQGAGLHVEAE
QRAMMVAEGNSTYLECLPRSRHAAVTWYKQAGENSPELHKVVSGDQLVLFERGVLIRRAE
LSHGGVYHCQLEEHGFLWTAVTFRLSVWSSSANHVITSWSEPTNQHTGRGRWYQDVMPLI
HPGDLGQHCRALGYRPPRNHRHHGDLEEPSTERKKEEGKPQLRAPRSA
Download sequence
Identical sequences ENSGMOP00000002572 ENSGMOP00000002572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]