SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002576 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002576
Domain Number 1 Region: 57-251
Classification Level Classification E-value
Superfamily Sema domain 5.1e-46
Family Sema domain 0.00013
Further Details:      
 
Domain Number 2 Region: 323-519
Classification Level Classification E-value
Superfamily Sema domain 1.57e-45
Family Sema domain 0.0000765
Further Details:      
 
Domain Number 3 Region: 515-562
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000152
Family Plexin repeat 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002576   Gene: ENSGMOG00000002420   Transcript: ENSGMOT00000002659
Sequence length 618
Comment pep:novel genescaffold:gadMor1:GeneScaffold_533:10:64412:-1 gene:ENSGMOG00000002420 transcript:ENSGMOT00000002659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PWRRWPLPFFLLLWLLRMTCSAFPEEPGPLNFIPTDVVRRYPVFLGRPHVTSLRQEPLLI
QRVLQVNRTLYIGARDDLFRVELDNVAGEEMFYSKKRTWESNKNDIRICRMKGKHEDECR
NFMKVLLSKAGGGLFICGTNAFNPMCANYTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XGNLFTATVTDFLAIDAVIYRSLGDHPALRTVKHDSKWFREPYFVSAVEWGPHIYFFFRE
MAMEFNYLEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXIPGSAVCAFDMEHLAGVFEGRFKEQKSPESIWTPVPD
ELIPKPRPGGCAVQGTRFNSSNAFPDEMLTFVKTHPLMEEAVASLGQRPWIVRTMVRYQL
NKMVVDSEAGPHRNRTVLFLGSSRGSILKFLIVPNQDNSVTSSNVFLEELEGYNPDNRCG
ESPQAKQLLSLTLDKPSHTLLLAFPSCVVRVPVARCQLYSRCMKNCIASRDPYCGWTRGS
TCSFLRPGTRLPFDQDIDHGSVNHLGDCDGLLQESFVEEPDGLVSVNLLVVSAVSAFATG
AVVSGLTVCWIMSHRHRR
Download sequence
Identical sequences ENSGMOP00000002576 ENSGMOP00000002576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]