SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002600 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002600
Domain Number 1 Region: 135-501
Classification Level Classification E-value
Superfamily Sema domain 2.35e-138
Family Sema domain 0.000000000625
Further Details:      
 
Domain Number 2 Region: 4-64
Classification Level Classification E-value
Superfamily Sema domain 0.000000000000497
Family Sema domain 0.001
Further Details:      
 
Domain Number 3 Region: 571-654
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000125
Family I set domains 0.065
Further Details:      
 
Domain Number 4 Region: 497-555
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000244
Family Plexin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002600   Gene: ENSGMOG00000002430   Transcript: ENSGMOT00000002685
Sequence length 710
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2470:292377:319607:1 gene:ENSGMOG00000002430 transcript:ENSGMOT00000002685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AYLLNTSDYRILRMDEDHDRMYVGSKDHILSLDLHDINKAPLIIHWPVSQQRRTECILSG
KDTNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMHLQMPQAGGRNSRS
AEATAVHETLGLKEYIFQLEPGKVDSGKGKCSYDPKLNSVSALINGELYAGVYIDFMGTD
SAIFRTLGKQTAMRTDQYNSRWLNDPSFVRVQLIPDSAERNDDKLYFFFREKSSEMGQSP
VTQSRIGRICLNDDGGHCCLVNKWSTFLKARLICSVPGADGMETHFDELRDVYIQPTQDT
KNPVIYGVFSVSGSVFKGSAVCVYSMADIRMVFNGPFAHKEGPNYQWVAYNGKIPYPRPG
TCPGGTFTPNMKSTKDYPDEVINFMRNHPTMYNAVYPLHKRPLVVRTNVDYEFTTITVDQ
VTAADGNYEVLFLGTDRGTVQKLIVLPSNGSLDEDLVLEELEVFKVPTPITTMKISSKRQ
QLYVSSVEGVTHLALHRCDVYGEACADCCLARDPYCAWDGKSCSRYSASQKRHHWSDPSR
RSRRQDVKYGNPIRQCRGFNSNVNKNTLEMVQYGVEGSSTFLECQARSPHALVKWHLQRD
NSDRRKEMRSDGRILKTEQGLLLRSLQPSDSGMYQCTGTEKNFKHTLVKMQLVVLSGRAV
NNVLVEGGAPGGPGDGAQWPNAGQYKDLLTILSQPEMGLINQYCQDYWQL
Download sequence
Identical sequences ENSGMOP00000002600 ENSGMOP00000002600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]