SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002628 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002628
Domain Number 1 Region: 25-142
Classification Level Classification E-value
Superfamily EF-hand 1.66e-31
Family EF-hand modules in multidomain proteins 0.0035
Further Details:      
 
Domain Number 2 Region: 144-202
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000884
Family EF-hand modules in multidomain proteins 0.018
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000002628
Domain Number - Region: 256-289
Classification Level Classification E-value
Superfamily RING/U-box 0.00494
Family ZZ domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002628   Gene: ENSGMOG00000002455   Transcript: ENSGMOT00000002713
Sequence length 660
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2759:354014:379792:1 gene:ENSGMOG00000002455 transcript:ENSGMOT00000002713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEDCGQSGHTMADRRQLFVEMRAQELDSIRLSTYRTACKLRFVQKKCNLHLVDIWNVIE
AFRETGLNTADLGGDVGVARLEAAVSAVFSQLNKRLPTTHQIAVEHSVSLLLNFLLAAYD
PEGLGKVSVFVVKTALAAICGGKYLDKLRYIFSQISDSAGVLAYSQFDQFLREVLKLPTA
VFEGPSFAYTEQAARTCFPQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCVC
VCVSVCSLPSSVIIKLCQGCFWRGMPAVHSNQHQMKEYTSWKSPAKKLSHALSKSLSCAS
NREPPHPMFPEMTSEKPLNLAHIVPPRPVNITNEYALSHSMPTSGNPFSTKHNDLELRRP
HLTRATPDLLRGRGVNYQLDVADRLADEHVLIGLYVNLLQNNPRSRFLESSSHQDDEHSL
IARYAARLAAGAAAQQQQQQQYGVVPSDFSCPLDANKHQRQLIAELEHKNREILQEIQRL
RIQHEQASQPTVDRNQQNPTLLAELRLLRQRKDELEQRMSTLQESRRELMVQLEQLMMLL
KEEEQKQATQGPSSPRSSLSHTACRPIPAPIHSESAGTTPTHTPQDSLMGVGGDVQEAFS
QGPRRNLRNDLLIAADSITSTMSFLVKELNSDCGSEMESLLDSDFEGSDSLAPSASDPFF
Download sequence
Identical sequences ENSGMOP00000002628 ENSGMOP00000002628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]