SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002669 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002669
Domain Number 1 Region: 13-168
Classification Level Classification E-value
Superfamily EF-hand 8.84e-36
Family Calmodulin-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002669   Gene: ENSGMOG00000002535   Transcript: ENSGMOT00000002754
Sequence length 179
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2296:1491417:1494742:1 gene:ENSGMOG00000002535 transcript:ENSGMOT00000002754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAHGSNLDAILEEDMHHWYNKFMRESPSGLITLFELKSMLQMKGMTEEASSYVDQIFLT
FDMDGDGYIDFVEYIAAVSLLLKGEINQKLKWYFKLFDQDGNGKIDKDEMETIFKXXXXX
TRSYEIPPEDIVTLVYEKIDVNGEGELTLEEFISGARLHSDIMDMLSKMMDLTHVLEII
Download sequence
Identical sequences ENSGMOP00000002669 ENSGMOP00000002669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]