SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002677 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002677
Domain Number 1 Region: 39-507
Classification Level Classification E-value
Superfamily Sema domain 3.14e-125
Family Sema domain 0.00000048
Further Details:      
 
Domain Number 2 Region: 1066-1328
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-75
Family Protein kinases, catalytic subunit 0.00000000596
Further Details:      
 
Domain Number 3 Region: 510-555
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000105
Family Plexin repeat 0.00087
Further Details:      
 
Domain Number 4 Region: 552-628
Classification Level Classification E-value
Superfamily E set domains 0.000000000182
Family Other IPT/TIG domains 0.048
Further Details:      
 
Domain Number 5 Region: 657-705
Classification Level Classification E-value
Superfamily E set domains 0.00000000672
Family Other IPT/TIG domains 0.059
Further Details:      
 
Domain Number 6 Region: 749-844
Classification Level Classification E-value
Superfamily E set domains 0.0000000389
Family E-set domains of sugar-utilizing enzymes 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002677   Gene: ENSGMOG00000002514   Transcript: ENSGMOT00000002762
Sequence length 1374
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2470:407697:426394:-1 gene:ENSGMOG00000002514 transcript:ENSGMOT00000002762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHWTTRWGTYLWVQTLLATATANCPSLVPSPTNFSVVYTMSFFQARSPIQNIVNNSLYQ
EVYIASQNVIEAVNQSLEKVWELPTGPVGSPECEICDMCDVDKDPNYLEDTDNQVLLLDT
LFMYLYSCGSSQYGVCYFHQLNTHGAPPSPSKCLFRKESNSAAYCPDCLASGLGTKVTLV
EEGQTVYFFVAVTVNDSVTQRYGRKSLSVRRPLATEDGFYRDVRGLTVLPGLRRTYGIRY
VYSFFTQEFVYFLSVQRESPDQESSPFQTRLGRLPRNEWEMKRYREVVLECRFEPKRRRR
NVASEPYRDVVYNVVQAAHFGRAGRELAAQLGAEEEDDILYGVFAVTGDDGATEDDSALC
AFPVDNVNTAIDDGVDDCCKSGPEQLSRGLCHFQPCESCPHESMEHNATCRDQPTMVSKP
YYRVDLFNRQMQDVLLTSLLVTIIENKTVAHIGTSTGRLLQLVLTRSSPVIFANYSLVEN
QRVSSIAAVYSSEYLLFVVGDKMFQVPQRGPGCQHYLTCAVCLMAPKFMGCGWCSGGCSW
EDECSVRWRNESCPPVITGFFPKTAPPDGQTELTVCGWEFQCPSKPDITSRTHQVRIGPT
ACAVQPSRSNNTHLVCKILSGAMELSKALTVNVEVHEGKVDWRYSIQGKAEMPGFMFVIP
NVTHIQPNYGPRVGGTLITITGPHLDAGKTRRVTLNDQPCPIKXXXXXXXXXXXXXXXXX
XISEVRDVPLSVFIDRSPVPTTKVFYYKENPEITAVLPDCSFDRGSKIVIEGKNLDSVYR
TAVRFKPDESHLRPVFRECKGKSLPTKMECLAPEFPQDETEKGQLSFDMDGAVGLWNGEF
SYHPYGEPIPFETEGHVLNLYPGFDEVSLHHQKLNLVSSCMTIIMTVAGVNCDAKVLDNE
ITCRIPKNMTIPSEGLPVKISINGQIHNVGTVVRVSNHYMVGIVLGILAALVAGAALAFA
VMKHLRKKKKASMVETRLGLNPNHSGTNNGDMSPVGDYRRVASIAPSSSMSGTVVFSGMA
YAAGGVDPTLAPLMPAEKISISSFRPELLEEVKDVLIPAQMLVVQRHRIIGKGHFGTVYH
GYFTDYNNREIHCAVKSLNRITDVEEVEQFLKEGIIMKGFHHTNVLSLLGILLPEEGLPL
VVLPYMKHGDLRHFIRCEKRNPTVKDLIGFGLQVATGMEYLAQKKFVHRDLAARNCMLDE
SYTVKVADFGMARDVFDKEYYSVQDHRKAKLPVKWMAIESLQTQKFTSKSDVWSFGVLMW
EMLTRGASPYPEVDPYDITHYLLKGRRLPQPQYCPDSLYSIMLQCWDPDSELRPSFATLV
FSVLSILSVLEGEHYISLKVTYVNLDQPRPYPALTESADECSSSDDGDKGSVSS
Download sequence
Identical sequences ENSGMOP00000002677 ENSGMOP00000002677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]