SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002802 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002802
Domain Number 1 Region: 472-722
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.92e-81
Family Hect, E3 ligase catalytic domain 0.0000000025
Further Details:      
 
Domain Number 2 Region: 16-133
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.18e-22
Family PLC-like (P variant) 0.00000916
Further Details:      
 
Domain Number 3 Region: 375-414
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000751
Family WW domain 0.00066
Further Details:      
 
Domain Number 4 Region: 304-338
Classification Level Classification E-value
Superfamily WW domain 0.00000000000111
Family WW domain 0.0014
Further Details:      
 
Domain Number 5 Region: 417-452
Classification Level Classification E-value
Superfamily WW domain 0.0000000000303
Family WW domain 0.00089
Further Details:      
 
Domain Number 6 Region: 274-304
Classification Level Classification E-value
Superfamily WW domain 0.000000049
Family WW domain 0.0025
Further Details:      
 
Domain Number 7 Region: 814-839
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 0.000000484
Family Hect, E3 ligase catalytic domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002802   Gene: ENSGMOG00000002629   Transcript: ENSGMOT00000002893
Sequence length 845
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1071:46862:77015:-1 gene:ENSGMOG00000002629 transcript:ENSGMOT00000002893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGVAMPGHTNGYPMKAQLQILVLSAKLKENRKNWFGPSPYVEVTVDGQSKKTATCNNT
HSPKWKQPLTVIVTPFSKLVFRVWSHQTLKADVLLGLATLDVSHTLQANQMKISEVVQTL
KLSADREQTDVGDLSVCLDGMTVDPEAFAAAQANRSRDGSPALDELEYRSSPPARGQRHS
SPSPSVTSEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWEQRVDLNGRLYFVDHVEKRTTW
ERPEPLPSGWERRVDPMGRVYFVDHITRTTTWQRPTMETVRNYEQWQHQRSQLQGAMQQF
NQRFIYGQDQVPAAQSDPLDSLPLGWEKRTDSTGRVYFVHHQTRTTQWEDPRTQGLLNEK
PLPEGWEMRFTVDGIPYFVDHNRRATTYIDPRTGKSSLENGPQITYVRDFKAKVQYFRFM
CQQHSMPQHIKITVSRKTLFEDSFQQIMSFNAQDLRRKLWIIFPGEEGLDYGGVAREWFF
LLSHEVLNPMYCLFEYAGKDNYCLQINPASYINPDHLKYFRFIGRFIAMALFHGKFIDTG
FSLPFYKRMLNKPWALKDLESIDPEFYNSLIWIKDNDIEECCLEMYFSVDKEILGEITTH
DLKEGGGDIQVTEENKEEYIRLVAEWRLSRGVEEQTQAFFEGFNEILPQQYLQYFDAKEL
EXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNRLDLPPYKSYEQLKEKLMFAIEETE
GFGQE
Download sequence
Identical sequences ENSGMOP00000002802 ENSGMOP00000002802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]